TKVBL-GVB vector (V001591)

Basic Vector Information

      • Vector Name:
      • TKVBL-GVB
      • Antibiotic Resistance:
      • Kanamycin
      • Length:
      • 7480 bp
      • Type:
      • Retrofitting vector
      • Source/Author:
      • Kondo S, Booker M, Perrimon N.

TKVBL-GVB vector Vector Map

TKVBL-GVB7480 bp300600900120015001800210024002700300033003600390042004500480051005400570060006300660069007200loxPgypsy insulatorSV40 poly(A) signalBSDcopia promoterSV40 poly(A) signalmVenusgypsy insulatorKanRoriVattBmini-Tn7 element (left end of the Tn7 transposon)

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

TKVBL-GVB vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                7480 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Retrofitting vector TKVBL-GVB, complete sequence.
ACCESSION   FJ804476
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7480)
  AUTHORS   Kondo S, Booker M, Perrimon N.
  TITLE     Cross-species RNAi rescue platform in Drosophila melanogaster
  JOURNAL   Genetics 183 (3), 1165-1173 (2009)
  PUBMED    19720858
REFERENCE   2  (bases 1 to 7480)
  AUTHORS   Kondo S, Booker M, Perrimon N.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-FEB-2009) Department of Genetics, Harvard Medical 
            School, 77 Avenue Louis Pasteur, Boston, MA 02115, USA
REFERENCE   3  (bases 1 to 7480)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..7480
                     /organism="Retrofitting vector TKVBL-GVB"
                     /mol_type="other DNA"
                     /db_xref="taxon:689696"
     protein_bind    complement(1107..1140)
                     /label=loxP
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (GCATACAT)."
     protein_bind    1457..1886
                     /label=gypsy insulator
                     /bound_moiety="Su(Hw), CP190, and Mod(mdg4)67.2"
                     /note="chromatin insulator from Drosophila"
     polyA_signal    1894..2028
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     CDS             complement(2357..2755)
                     /codon_start=1
                     /gene="Aspergillus terreus BSD"
                     /product="blasticidin S deaminase"
                     /label=BSD
                     /note="confers resistance to blasticidin"
                     /translation="MAKPLSQEESTLIERATATINSIPISEDYSVASAALSSDGRIFTG
                     VNVYHFTGGPCAELVVLGTAAAAAAGNLTCIVAIGNENRGILSPCGRCRQVLLDLHPGI
                     KAIVKDSDGQPTAVGIRELLPSGYVWEG"
     promoter        complement(2772..3051)
                     /label=copia promoter
                     /note="strong promoter from the Drosophila transposable 
                     element copia (Sinclair et al., 1986)"
     polyA_signal    3171..3252
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     CDS             complement(3378..4097)
                     /codon_start=1
                     /product="Venus YFP with monomerizing A206K mutation (Nagai
                     et al., 2002)"
                     /label=mVenus
                     /note="mammalian codon-optimized"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK
                     ANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLL
                     EFVTAAGITLGMDELYK"
     regulatory      4094..4103
                     /regulatory_class="other"
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     protein_bind    4631..5060
                     /label=gypsy insulator
                     /bound_moiety="Su(Hw), CP190, and Mod(mdg4)67.2"
                     /note="chromatin insulator from Drosophila"
     CDS             complement(5388..6203)
                     /codon_start=1
                     /gene="aph(3')-Ia"
                     /product="aminoglycoside phosphotransferase"
                     /label=KanR
                     /note="confers resistance to kanamycin in bacteria or G418 
                     (Geneticin(R)) in eukaryotes"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     rep_origin      6340..6954
                     /label=oriV
                     /note="origin of replication for the bacterial F plasmid"
     rep_origin      6431..6962
                     /label=oriV
                     /note="incP origin of replication"
     protein_bind    6997..7066
                     /label=attB
                     /bound_moiety="phage phi-C31 integrase"
                     /note="attB site for the phi-C31 integrase (Groth et al., 
                     2000)"
     mobile_element  7292..7457
                     /mobile_element_type="transposon:Tn7"
                     /note="mini-Tn7 element (left end of the Tn7 transposon)"

This page is informational only.