Basic Vector Information
- Vector Name:
- SBa_000559
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5208 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Temme K, Zhao D, Voigt CA.
- Promoter:
- araBAD
SBa_000559 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
SBa_000559 vector Sequence
LOCUS 40924_48753 5208 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector SBa_000559, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5208) AUTHORS Temme K, Zhao D, Voigt CA. TITLE Refactoring the nitrogen fixation gene cluster from Klebsiella oxytoca JOURNAL Proc. Natl. Acad. Sci. U.S.A. 109 (18), 7085-7090 (2012) PUBMED 22509035 REFERENCE 2 (bases 1 to 5208) AUTHORS Temme K, Zhao D, Voigt CA. TITLE Direct Submission JOURNAL Submitted (05-APR-2012) Biological Engineering, MIT, 500 Technology Square, Cambridge, MA 02139, USA REFERENCE 3 (bases 1 to 5208) TITLE Direct Submission REFERENCE 4 (bases 1 to 5208) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl. Acad. Sci. U.S.A."; date: "2012"; volume: "109"; issue: "18"; pages: "7085-7090" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (05-APR-2012) Biological Engineering, MIT, 500 Technology Square, Cambridge, MA 02139, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5208 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 43..64 /label=BioBrick prefix /note="BioBrick prefix for parts that do not start with 'ATG'" promoter 64..348 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" protein_bind 377..395 /label=tet operator /note="bacterial operator O2 for the tetR and tetA genes" CDS 456..1166 /codon_start=1 /label=lambda repressor /note="phage lambda repressor" /translation="MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ SGVGALFNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY PVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDSAFWLEVEGNSMTAPTGSKPSFPD GMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSV VGKVIASQWPEETFG" CDS 1167..1199 /codon_start=1 /label=ssrA tag (LVA) /note="C-terminal peptide that mediates degradation in bacteria through the ClpXP and ClpAP proteases (McGinness et al., 2006)" /translation="AANDENYALVA" terminator 1247..1318 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 1334..1361 /label=T7Te terminator /note="phage T7 early transcription terminator" CDS 1435..2310 /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" CDS 2340..2960 /codon_start=1 /label=TetR /note="tetracycline repressor TetR" /translation="MSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHV KNKRALLDALAIEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGTR PTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKEERETPTT DSMPPLLRQAIELFDHQGAEPAFLFGLELIICGLEKQLKCESGS" misc_feature 2967..2987 /label=BioBrick suffix /note="universal suffix for all parts" terminator 2988..3047 /label=his operon terminator /note="This putative transcriptin terminator from the E. coli his operon has a 2-bp deletion introduced during synthesis. Its efficiency has not been determined." rep_origin complement(3294..3881) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(3969..4063) /label=lambda t0 terminator /note="transcription terminator from phage lambda" CDS complement(4087..4944) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" promoter complement(4945..5016) /label=AmpR promoter terminator complement(join(5205..5208,1..40)) /label=bacterial terminator /note="putative bacterial transcription terminator"
This page is informational only.