Cart 2

rpDR2 vector (V001604#)

Basic Vector Information

Basic Vector Information
Vector Name rpDR2 Antibiotic Resistance Ampicillin
Length 10850 bp Type Cloning vector
Source Kitts PA.

rpDR2 vector Vector Map

RSV promoter M13 fwd SV40 poly(A) signal HSV TK poly(A) signal HygR HSV TK promoter ori AmpR AmpR promoter loxP EBNA1 oriP

rpDR2 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported               10850 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector rpDR2, complete sequence.
ACCESSION   U02455
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10850)
  AUTHORS   Kitts PA.
  TITLE     CLONTECH Vectors On Disc version 1.3
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10850)
  AUTHORS   Murphy AJ, Kung AL, Swirski RA, Schimke RT.
  TITLE     cDNA expression cloning in human cells using the plambdaDR2 episomal
            vector system
  JOURNAL   Methods: A Companion to Methods in Enzymology 4, 111-131 (1992)
REFERENCE   3  (bases 1 to 10850)
  AUTHORS   Kitts PA.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-OCT-1993) Paul A. Kitts, CLONTECH Laboratories, Inc., 
            1020 East Meadow Circle, Palo Alto, CA 94303, USA
REFERENCE   4  (bases 1 to 10850)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     Lambda DR2 can be obtained from CLONTECH Laboratories, Inc., 1020 
            East Meadow Circle, Palo Alto, CA 94303, USA. To place an order call
            (415) 424-8222 or (800) 662-2566, extension 1. International 
            customers, please contact your local distributor.  For technical 
            information, call (415) 424- 8222 or (800) 662-2566, extension 3. 
            This sequence was compiled by Andrew Murphy and revised at CLONTECH.
            If you suspect there is an error in this sequence, please contact 
            CLONTECH's Technical Service Department at (415) 424-8222 or (800) 
            662-2566, extension 3 or E-mail TECH@CLONTECH.COM.
FEATURES             Location/Qualifiers
     source          1..10850
                     /organism="Cloning vector rpDR2"
                     /mol_type="genomic DNA"
                     /label=plasmid released from lambda DR2
                     /note="plasmid released from lambda DR2"
                     /db_xref="taxon:31858"
     promoter        407..669
                     /label=RSV promoter
                     /note="Rous sarcoma virus enhancer/promoter"
     primer_bind     complement(786..802)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     polyA_signal    901..1035
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     polyA_signal    2322..2370
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase 
                     polyadenylation signal (Cole and Stacy, 1985)"
     CDS             complement(2412..3449)
                     /codon_start=1
                     /product="hygromycin B phosphotransferase"
                     /label=HygR
                     /note="confers resistance to hygromycin"
                     /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG
                     YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP
                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ
                     TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF
                     GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG
                     NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRGDRE
                     MGEAN"
     promoter        complement(3484..3629)
                     /label=HSV TK promoter
                     /note="herpes simplex virus thymidine kinase promoter"
     rep_origin      complement(4086..4674)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(4845..5705)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=AmpR
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
     promoter        complement(5706..5810)
                     /gene="bla"
                     /label=AmpR promoter
     protein_bind    5977..6010
                     /label=loxP
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (GCATACAT)."
     CDS             6444..8369
                     /codon_start=1
                     /product="Epstein-Barr nuclear antigen 1, also known as 
                     EBNA-1"
                     /label=EBNA1
                     /note="crucial for latent viral infection, and for episomal
                     amplification of vectors containing the oriP origin (Okita 
                     et al., 2013)"
                     /translation="MSDEGPGTGPGNGLGEKGDTSGPEGSGGSGPQRRGGDNHGRGRGR
                     GRGRGGGRPGAPGGSGSGPRHRDGVRRPQKRPSCIGCKGTHGGTGAGAGAGGAGAGGAG
                     AGGGAGAGGGAGGAGGAGGAGAGGGAGAGGGAGGAGGAGAGGGAGAGGGAGGAGAGGGA
                     GGAGGAGAGGGAGAGGGAGGAGAGGGAGGAGGAGAGGGAGAGGAGGAGGAGAGGAGAGG
                     GAGGAGGAGAGGAGAGGAGAGGAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGGAGAG
                     GGAGGAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGAGGAGAGGGGRGRGGSGGRGRG
                     GSGGRGRGGSGGRRGRGRERARGGSRERARGRGRGRGEKRPRSPSSQSSSSGSPPRRPP
                     PGRRPFFHPVGEADYFEYHQEGGPDGEPDVPPGAIEQGPADDPGEGPSTGPRGQGDGGR
                     RKKGGWFGKHRGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGVFVYGGSKTSL
                     YNLRRGTALAIPQCRLTPLSRLPFGMAPGPGPQPGPLRESIVCYFMVFLQTHIFAEVLK
                     DAIKDLVMTKPAPTCNIRVTVCSFDDGVDLPPWFPPMVEGAAAEGDDGDDGDEGGDGDE
                     GEEGQE"
     rep_origin      8671..10460
                     /label=oriP
                     /note="Epstein-Barr virus oriP replication origin (Yates et
                     al., 2000)"

This page is informational only.