murine TCR OTI-2A.pMIG II vector (Cat. No.: V001766)
Note: murine TCR OTI-2A.pMIG II is a retroviral plasmid used to express the mouse T cell receptor (TCR). It enables efficient expression of the TCRalpha and TCRbeta from a single vector, and also labels successfully transduced cells.
- Name:
- murine TCR OTI-2A.pMIG II
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8327 bp
- Type:
- Mammalian Expression, Retroviral
- Replication origin:
- ori
- Copy Number:
- High Copy
- Promoter:
- MSCV
- 5' Primer:
- na
- 3' Primer:
- EGFP-N
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Holst J, Szymczak-Workman AL, Vignali KM, Burton AR, Workman CJ, Vignali DA. Generation of T-cell receptor retrogenic mice. Nat Protoc. 2006;1(1):406-17. doi: 10.1038/nprot.2006.61. PMID: 17406263.
murine TCR OTI-2A.pMIG II vector (Cat. No.: V001766) Sequence
LOCUS Exported 8327 bp DNA circular SYN 15-JAN-2025
DEFINITION Exported.
ACCESSION V001766
VERSION .
KEYWORDS murine TCR OTI-2A.pMIG II
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 8327)
AUTHORS Holst J, Szymczak-Workman AL, Vignali KM, Burton AR, Workman CJ,
Vignali DA
TITLE Generation of T-cell receptor retrogenic mice.
JOURNAL Nat Protoc. 2006;1(1):406-17.
PUBMED 17406263
REFERENCE 2 (bases 1 to 8327)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 8327)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 8327)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat
Protoc."; date: "2006"; volume: "1(1)"
COMMENT SGRef: number: 2; type: "Journal Article"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..8327
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 1..515
/label=MSCV
/note="Murine embryonic stem cell virus promoter including
the enhancer and promoter region of PCMV virus and 5'
untranslated region of dl-587rev retrovirus"
misc_feature 579..920
/label=MESV Psi
/note="packaging signal of murine embryonic stem cell
virus"
CDS 987..1403
/label=gag (truncated)
/note="truncated Moloney murine leukemia virus (MMLV) gag
gene lacking the start codon"
CDS 1420..1782
/codon_start=1
/label=T cell receptor variable and J region
/translation="MDKILTASFLLLGLHLAGVNGQQQEKRDQQQVRQSPQSLTVWEGE
TAILNCSYEDSTFNYFPWYQQFPGEGPALLISIRSVSDKKEDGRFTIFFNKREKKLSLH
ITDSQPGDSATYFCAAS"
CDS 1837..2244
/gene="Trac"
/label=T-cell receptor alpha chain constant
/note="T-cell receptor alpha chain constant from Mus
musculus. Accession#: P01849"
CDS 2248..2301
/label=T2A
/note="2A peptide from Thosea asigna virus capsid protein"
CDS 2323..2721
/codon_start=1
/label=T-cell receptor beta chain V region
/translation="DSAWGITLLSWVTVFLLGTSSADSGVVQSPRHIIKEKGGRSVLTC
IPISGHSNVVWYQQTLGKELKFLIQHYEKVERDKGFLPSRFSVQQFDDYHSEMNMSALE
LEDSAMYFCASSRANYEQYFGPGTRLTVL"
CDS 2722..3240
/codon_start=1
/label=T-cell receptor beta-2 chain C region
/translation="EDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSW
WVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDK
WPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVSGLV
LMAMVKKKNS"
misc_feature 3275..3836
/label=IRES
/note="internal ribosome entry site (IRES) of the
encephalomyocarditis virus (EMCV)"
CDS 3839..4555
/label=EGFP
/note="enhanced GFP"
LTR 4720..5234
/label=3' LTR
/note="3' long terminal repeat from murine embryonic stem
cell virus"
protein_bind complement(5396..5412)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(5420..5450)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(5465..5486)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
primer_bind complement(5603..5620)
/label=L4440
/note="L4440 vector, forward primer"
rep_origin complement(5774..6362)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(6536..7393)
/label=AmpR
/note="beta-lactamase"
promoter complement(7394..7498)
/label=AmpR promoter
primer_bind 7566..7584
/label=pBRforEco
/note="pBR322 vectors, upsteam of EcoRI site, forward
primer"
primer_bind complement(7622..7644)
/label=pGEX 3'
/note="pGEX vectors, reverse primer"
primer_bind 7744..7763
/label=pRS-marker
/note="pRS vectors, use to sequence yeast selectable
marker"
primer_bind 7957..7979
/label=M13/pUC Forward
/note="In lacZ gene"
primer_bind 8107..8126
/label=pBRrevBam
/note="pBR322 vectors, tet region, downstream of BamHI,
reverse primer"
LTR 8326..8327
/label=5' LTR
/note="5' long terminal repeat from murine embryonic stem
cell virus"