murine TCR OTI-2A.pMIG II vector (V001766)

Price Information

Cat No. Plasmid Name Availability Buy one, get one free! (?)
V001766 murine TCR OTI-2A.pMIG II In stock, 1 week for quality controls

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

Vector Name:
murine TCR OTI-2A.pMIG II
Antibiotic Resistance:
Ampicillin
Length:
8327 bp
Type:
Mammalian Expression, Retroviral
Replication origin:
ori
Copy Number:
High Copy
Promoter:
MSCV
5' Primer:
na
3' Primer:
EGFP-N

murine TCR OTI-2A.pMIG II vector Map

murine TCR OTI-2A.pMIG II8327 bp400800120016002000240028003200360040004400480052005600600064006800720076008000MSCVMESV Psigag (truncated)T cell receptor variable and J regionTracT2AT-cell receptor beta chain V regionT-cell receptor beta-2 chain C regionIRESEGFP3' LTRlac operatorlac promoterCAP binding siteL4440oriAmpRAmpR promoterpBRforEcopGEX 3'pRS-markerM13/pUC ForwardpBRrevBam5' LTR

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

murine TCR OTI-2A.pMIG II vector Sequence

LOCUS       Exported                8327 bp DNA     circular SYN 15-JAN-2025
DEFINITION  Exported.
ACCESSION   V001766
VERSION     .
KEYWORDS    murine TCR OTI-2A.pMIG II
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8327)
  AUTHORS   Holst J, Szymczak-Workman AL, Vignali KM, Burton AR, Workman CJ, 
            Vignali DA
  TITLE     Generation of T-cell receptor retrogenic mice.
  JOURNAL   Nat Protoc. 2006;1(1):406-17.
  PUBMED    17406263
REFERENCE   2  (bases 1 to 8327)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 8327)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8327)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nat
            Protoc."; date: "2006"; volume: "1(1)"
COMMENT     SGRef: number: 2; type: "Journal Article"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8327
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        1..515
                     /label=MSCV
                     /note="Murine embryonic stem cell virus promoter including
                     the enhancer and promoter region of PCMV virus and 5' 
                     untranslated region of dl-587rev retrovirus"
     misc_feature    579..920
                     /label=MESV Psi
                     /note="packaging signal of murine embryonic stem cell
                     virus"
     CDS             987..1403
                     /label=gag (truncated)
                     /note="truncated Moloney murine leukemia virus (MMLV) gag
                     gene lacking the start codon"
     CDS             1420..1782
                     /codon_start=1
                     /label=T cell receptor variable and J region
                     /translation="MDKILTASFLLLGLHLAGVNGQQQEKRDQQQVRQSPQSLTVWEGE
                     TAILNCSYEDSTFNYFPWYQQFPGEGPALLISIRSVSDKKEDGRFTIFFNKREKKLSLH
                     ITDSQPGDSATYFCAAS"
     CDS             1837..2244
                     /gene="Trac"
                     /label=T-cell receptor alpha chain constant
                     /note="T-cell receptor alpha chain constant from Mus
                     musculus. Accession#: P01849"
     CDS             2248..2301
                     /label=T2A
                     /note="2A peptide from Thosea asigna virus capsid protein"
     CDS             2323..2721
                     /codon_start=1
                     /label=T-cell receptor beta chain V region
                     /translation="DSAWGITLLSWVTVFLLGTSSADSGVVQSPRHIIKEKGGRSVLTC
                     IPISGHSNVVWYQQTLGKELKFLIQHYEKVERDKGFLPSRFSVQQFDDYHSEMNMSALE
                     LEDSAMYFCASSRANYEQYFGPGTRLTVL"
     CDS             2722..3240
                     /codon_start=1
                     /label=T-cell receptor beta-2 chain C region
                     /translation="EDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSW
                     WVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDK
                     WPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVSGLV
                     LMAMVKKKNS"
     misc_feature    3275..3836
                     /label=IRES
                     /note="internal ribosome entry site (IRES) of the 
                     encephalomyocarditis virus (EMCV)"
     CDS             3839..4555
                     /label=EGFP
                     /note="enhanced GFP"
     LTR             4720..5234
                     /label=3' LTR
                     /note="3' long terminal repeat from murine embryonic stem
                     cell virus"
     protein_bind    complement(5396..5412)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(5420..5450)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(5465..5486)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     primer_bind     complement(5603..5620)
                     /label=L4440
                     /note="L4440 vector, forward primer"
     rep_origin      complement(5774..6362)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(6536..7393)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(7394..7498)
                     /label=AmpR promoter
     primer_bind     7566..7584
                     /label=pBRforEco
                     /note="pBR322 vectors, upsteam of EcoRI site, forward
                     primer"
     primer_bind     complement(7622..7644)
                     /label=pGEX 3'
                     /note="pGEX vectors, reverse primer"
     primer_bind     7744..7763
                     /label=pRS-marker
                     /note="pRS vectors, use to sequence yeast selectable
                     marker"
     primer_bind     7957..7979
                     /label=M13/pUC Forward
                     /note="In lacZ gene"
     primer_bind     8107..8126
                     /label=pBRrevBam
                     /note="pBR322 vectors, tet region, downstream of BamHI,
                     reverse primer"
     LTR             8326..8327
                     /label=5' LTR
                     /note="5' long terminal repeat from murine embryonic stem
                     cell virus"