Basic Vector Information
pDsRed1-C1 encodes a novel red fluorescent protein (DsRed1; 1) that has been optimized for high expression in mammalian cells (excitation maximum = 558 nm; emission maximum = 583 nm.). Red fluorescent protein was originally isolated from an IndoPacific sea anemone relative, Discosoma sp.DsRed1’s coding sequence contains 144 silent base pair changes, which correspond to human codon-usage preferences for high expression in mammalian cells. A nucleotide sequence upstream of DsRed1 has been converted to a Kozak consensus translation initiation site to further increase the translation efficiency in eukaryotic cells. The multiple cloning site (MCS) in pDsRed1-C1 is positioned between the DsRed1 coding sequence and the SV40 polyadenylation signal (SV40 poly A). Genes cloned into the MCS will be expressed as fusions to the C-terminus of DsRed1 if they are in the same reading frame as DsRed1 and there are no intervening stop codons. SV40 poly A signals downstream of the MCS direct proper processing of the 3' end of mRNA transcripts. The vector backbone also contains an SV40 origin for replication in mammalian cells expressing the SV40 T-antigen. A neomycin resistance cassette (Neor), consisting of the SV40 early promoter, the neomycin/kanamycin resistance gene of Tn5, and polyadenylation signals from the Herpes simplex virus thymidine kinase (HSV TK) gene, allows stably transfected eukaryotic cells to be selected using G418. A bacterial promoter upstream of this cassette expresses kanamycin resistance in E. coli. The pDsRed1-C1 backbone also provides a pUC origin of replication for propagation in E. coli and an f1 origin for single-stranded DNA production.pDsRed1-C1 can be used to construct fusions to the C-terminus of DsRed1. If a fusion construct retains the fluorescent properties of the native DsRed1 protein, its expression and localization in vivo can be monitored by fluorescence microscopy or flow cytometry. The target gene should be cloned into pDsRed1-C1 so that it is in frame with the DsRed1 coding sequences, with no intervening inframe stop codons. The recombinant DsRed1 vector can be transfected into mammalian cells using any standard transfection method. If required, stable transformants can be selected using G418 (4). pDsRed1-C1 can also be used simply to express DsRed1 in a cell line of interest (e.g., as a cotransfection marker).
- Vector Name:
- pDsRed1-C1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4686 bp
- Type:
- Fluorescent Protein Reporter Vectors
- Replication origin:
- ori
- Selection Marker:
- Neomycin
- Promoter:
- CMV
pDsRed1-C1 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pDsRed1-C1 vector Sequence
LOCUS 40924_15680 4686 bp DNA circular SYN 13-JAN-2022
DEFINITION synthetic circular DNA.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4686)
TITLE Direct Submission
REFERENCE 2 (bases 1 to 4686)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4686
/mol_type="other DNA"
/organism="synthetic DNA construct"
enhancer 61..364
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 365..568
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
CDS 613..1290
/codon_start=1
/label=DsRed1
/note="wild-type DsRed"
/translation="MVRSSKNVIKEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGHNTV
KLKVTKGGPLPFAWDILSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGG
VVTVTQDSSLQDGCFIYKVKFIGVNFPSDGPVMQKKTMGWEASTERLYPRDGVLKGEIH
KALKLKDGGHYLVEFKSIYMAKKPVQLPGYYYVDSKLDITSHNEDYTIVEQYERTEGRH
HLFL"
misc_feature 1294..1350
/label=MCS
/note="multiple cloning site"
polyA_signal 1474..1595
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
rep_origin complement(1602..2057)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 2084..2188
/label=AmpR promoter
promoter 2190..2547
/label=SV40 promoter
/note="SV40 enhancer and early promoter"
CDS 2582..3373
/codon_start=1
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
/translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
polyA_signal 3608..3655
/label=HSV TK poly(A) signal
/note="herpes simplex virus thymidine kinase
polyadenylation signal (Cole and Stacy, 1985)"
rep_origin 3984..4572
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.