Cart 2

P{attP.w+.attP} vector (V001815#)

Basic Vector Information

Basic Vector Information
Vector Name P{attP.w+.attP} Antibiotic Resistance Ampicillin
Length 8266 bp Type Cloning vector
Source Bateman JR, Wu CT.

P{attP.w+.attP} vector Vector Map

P-element 3' end attP mini-white dominant eye marker attP P-element 5' end ori AmpR AmpR promoter

P{attP.w+.attP} vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                8266 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector P{attP.w+.attP}, complete sequence.
ACCESSION   EU761203
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8266)
  AUTHORS   Bateman JR, Wu CT.
  TITLE     A simple polymerase chain reaction-based method for the construction
            of recombinase-mediated cassette exchange donor vectors
  JOURNAL   Genetics 180 (3), 1763-1766 (2008)
  PUBMED    18791223
REFERENCE   2  (bases 1 to 8266)
  AUTHORS   Bateman JR.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-MAY-2008) Genetics, Harvard Medical School, 77 Avenue 
            Louis Pasteur, Boston, MA 02115, USA
REFERENCE   3  (bases 1 to 8266)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..8266
                     /organism="Cloning vector P{attP.w+.attP}"
                     /mol_type="other DNA"
                     /db_xref="taxon:535311"
     misc_feature    1..234
                     /label=P-element 3' end
                     /note="P-element 3' end"
     misc_feature    1..233
                     /label=P element 3' end
                     /note="P element 3' end"
     misc_recomb     302..522
                     /label=attP
                     /note="attP"
     protein_bind    365..464
                     /label=phage phi-C31 attP
                     /bound_moiety="phage phi-C31 integrase"
                     /note="attachment site of phage phi-C31"
     misc_feature    549..4569
                     /label=mini-white dominant eye marker
                     /note="mini-white dominant eye marker"
     CDS             join(1035..1106,1501..1774,1849..2503,2565..2880,3101..3232,
                     3303..3917)
                     /codon_start=1
                     /gene="white"
                     /product="Drosophila white gene eye color pigment"
                     /label=mini-white
                     /note="This is a modified version of the white gene lacking
                     part of the first intron."
                     /translation="MGQEDQELLIRGGSKHPSAEHLNNGDSGAASQSCINQGFGQAKNY
                     GTLLPPSPPEDSGSGSGQLAENLTYAWHNMDIFGAVNQPGSGWRQLVNRTRGLFCNERH
                     IPAPRKHLLKNVCGVAYPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRLLNG
                     QPVDAKEMQARCAYVQQDDLFIGSLTAREHLIFQAMVRMPRHLTYRQRVARVDQVIQEL
                     SLSKCQHTIIGVPGRVKGLSGGERKRLAFASEALTDPPLLICDEPTSGLDSFTAHSVVQ
                     VLKKLSQKGKTVILTIHQPSSELFELFDKILLMAEGRVAFLGTPSEAVDFFSYVGAQCP
                     TNYNPADFYVQVLAVVPGREIESRDRIAKICDNFAISKVARDMEQLLATKNLEKPLEQP
                     ENGYTYKATWFMQFRAVLWRSWLSVLKEPLLVKVRLIQTTMVAILIGLIFLGQQLTQVG
                     VMNINGAIFLFLTNMTFQNVFATINVFTSELPVFMREARSRLYRCDTYFLGKTIAELPL
                     FLTVPLVFTAIAYPMIGLRAGVLHFFNCLALVTLVANVSTSFGYLISCASSSTSMALSV
                     GPPVIIPFLLFGGFFLNSGSVPVYLKWLSYLSWFRYANEGLLINQWADVEPGEISCTSS
                     NTTCPSSGKVILETLNFSAADLPLDYVGLAILIVSFRVLAYLALRLRARRKE"
     misc_recomb     4574..4794
                     /label=attP
                     /note="attP"
     protein_bind    4632..4731
                     /label=phage phi-C31 attP
                     /bound_moiety="phage phi-C31 integrase"
                     /note="attachment site of phage phi-C31"
     misc_feature    4915..5506
                     /label=P-element 5' end
                     /note="P-element 5' end"
     misc_feature    4921..5506
                     /label=P element 5' end
     rep_origin      complement(5741..6329)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(6500..7360)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=AmpR
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(7361..7465)
                     /gene="bla"
                     /label=AmpR promoter

This page is informational only.