Basic Vector Information
- Vector Name:
- P{attP.w+.attP}
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8266 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Bateman JR, Wu CT.
P{attP.w+.attP} vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
P{attP.w+.attP} vector Sequence
LOCUS 40924_48643 8266 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector P{attP.w+.attP}, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8266) AUTHORS Bateman JR, Wu CT. TITLE A simple polymerase chain reaction-based method for the construction of recombinase-mediated cassette exchange donor vectors JOURNAL Genetics 180 (3), 1763-1766 (2008) PUBMED 18791223 REFERENCE 2 (bases 1 to 8266) AUTHORS Bateman JR. TITLE Direct Submission JOURNAL Submitted (15-MAY-2008) Genetics, Harvard Medical School, 77 Avenue Louis Pasteur, Boston, MA 02115, USA REFERENCE 3 (bases 1 to 8266) TITLE Direct Submission REFERENCE 4 (bases 1 to 8266) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Genetics"; date: "2008"; volume: "180"; issue: "3"; pages: "1763-1766" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-MAY-2008) Genetics, Harvard Medical School, 77 Avenue Louis Pasteur, Boston, MA 02115, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8266 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(1..233) /label=P element 3' end /note="P element 3' end" protein_bind 365..464 /label=phage phi-C31 attP /note="attachment site of phage phi-C31" misc_feature 549..4569 /label=mini-white dominant eye marker /note="mini-white dominant eye marker" CDS join(1035..1106,1501..1774,1849..2503,2565..2880,3101..3232, 3303..3917) /codon_start=1 /gene="white" /product="Drosophila white gene eye color pigment" /label=mini-white /note="This is a modified version of the white gene lacking part of the first intron." /translation="MGQEDQELLIRGGSKHPSAEHLNNGDSGAASQSCINQGFGQAKNY GTLLPPSPPEDSGSGSGQLAENLTYAWHNMDIFGAVNQPGSGWRQLVNRTRGLFCNERH IPAPRKHLLKNVCGVAYPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRLLNG QPVDAKEMQARCAYVQQDDLFIGSLTAREHLIFQAMVRMPRHLTYRQRVARVDQVIQEL SLSKCQHTIIGVPGRVKGLSGGERKRLAFASEALTDPPLLICDEPTSGLDSFTAHSVVQ VLKKLSQKGKTVILTIHQPSSELFELFDKILLMAEGRVAFLGTPSEAVDFFSYVGAQCP TNYNPADFYVQVLAVVPGREIESRDRIAKICDNFAISKVARDMEQLLATKNLEKPLEQP ENGYTYKATWFMQFRAVLWRSWLSVLKEPLLVKVRLIQTTMVAILIGLIFLGQQLTQVG VMNINGAIFLFLTNMTFQNVFATINVFTSELPVFMREARSRLYRCDTYFLGKTIAELPL FLTVPLVFTAIAYPMIGLRAGVLHFFNCLALVTLVANVSTSFGYLISCASSSTSMALSV GPPVIIPFLLFGGFFLNSGSVPVYLKWLSYLSWFRYANEGLLINQWADVEPGEISCTSS NTTCPSSGKVILETLNFSAADLPLDYVGLAILIVSFRVLAYLALRLRARRKE" protein_bind complement(4632..4731) /label=phage phi-C31 attP /note="attachment site of phage phi-C31" misc_feature complement(4921..5506) /label=P element 5' end rep_origin complement(5741..6329) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(6503..7360) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(7361..7465) /label=AmpR promoter
This page is informational only.