P{attP.w+.attP} vector (V001815)

Basic Vector Information

      • Vector Name:
      • P{attP.w+.attP}
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 8266 bp
      • Type:
      • Cloning vector
      • Source/Author:
      • Bateman JR, Wu CT.

P{attP.w+.attP} vector Vector Map

P{attP.w+.attP}8266 bp400800120016002000240028003200360040004400480052005600600064006800720076008000P-element 3' endattPmini-white dominant eye markerattPP-element 5' endoriAmpRAmpR promoter

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

P{attP.w+.attP} vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                8266 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector P{attP.w+.attP}, complete sequence.
ACCESSION   EU761203
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8266)
  AUTHORS   Bateman JR, Wu CT.
  TITLE     A simple polymerase chain reaction-based method for the construction
            of recombinase-mediated cassette exchange donor vectors
  JOURNAL   Genetics 180 (3), 1763-1766 (2008)
  PUBMED    18791223
REFERENCE   2  (bases 1 to 8266)
  AUTHORS   Bateman JR.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-MAY-2008) Genetics, Harvard Medical School, 77 Avenue 
            Louis Pasteur, Boston, MA 02115, USA
REFERENCE   3  (bases 1 to 8266)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..8266
                     /organism="Cloning vector P{attP.w+.attP}"
                     /mol_type="other DNA"
                     /db_xref="taxon:535311"
     misc_feature    1..234
                     /label=P-element 3' end
                     /note="P-element 3' end"
     misc_feature    1..233
                     /label=P element 3' end
                     /note="P element 3' end"
     misc_recomb     302..522
                     /label=attP
                     /note="attP"
     protein_bind    365..464
                     /label=phage phi-C31 attP
                     /bound_moiety="phage phi-C31 integrase"
                     /note="attachment site of phage phi-C31"
     misc_feature    549..4569
                     /label=mini-white dominant eye marker
                     /note="mini-white dominant eye marker"
     CDS             join(1035..1106,1501..1774,1849..2503,2565..2880,3101..3232,
                     3303..3917)
                     /codon_start=1
                     /gene="white"
                     /product="Drosophila white gene eye color pigment"
                     /label=mini-white
                     /note="This is a modified version of the white gene lacking
                     part of the first intron."
                     /translation="MGQEDQELLIRGGSKHPSAEHLNNGDSGAASQSCINQGFGQAKNY
                     GTLLPPSPPEDSGSGSGQLAENLTYAWHNMDIFGAVNQPGSGWRQLVNRTRGLFCNERH
                     IPAPRKHLLKNVCGVAYPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRLLNG
                     QPVDAKEMQARCAYVQQDDLFIGSLTAREHLIFQAMVRMPRHLTYRQRVARVDQVIQEL
                     SLSKCQHTIIGVPGRVKGLSGGERKRLAFASEALTDPPLLICDEPTSGLDSFTAHSVVQ
                     VLKKLSQKGKTVILTIHQPSSELFELFDKILLMAEGRVAFLGTPSEAVDFFSYVGAQCP
                     TNYNPADFYVQVLAVVPGREIESRDRIAKICDNFAISKVARDMEQLLATKNLEKPLEQP
                     ENGYTYKATWFMQFRAVLWRSWLSVLKEPLLVKVRLIQTTMVAILIGLIFLGQQLTQVG
                     VMNINGAIFLFLTNMTFQNVFATINVFTSELPVFMREARSRLYRCDTYFLGKTIAELPL
                     FLTVPLVFTAIAYPMIGLRAGVLHFFNCLALVTLVANVSTSFGYLISCASSSTSMALSV
                     GPPVIIPFLLFGGFFLNSGSVPVYLKWLSYLSWFRYANEGLLINQWADVEPGEISCTSS
                     NTTCPSSGKVILETLNFSAADLPLDYVGLAILIVSFRVLAYLALRLRARRKE"
     misc_recomb     4574..4794
                     /label=attP
                     /note="attP"
     protein_bind    4632..4731
                     /label=phage phi-C31 attP
                     /bound_moiety="phage phi-C31 integrase"
                     /note="attachment site of phage phi-C31"
     misc_feature    4915..5506
                     /label=P-element 5' end
                     /note="P-element 5' end"
     misc_feature    4921..5506
                     /label=P element 5' end
     rep_origin      complement(5741..6329)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(6500..7360)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=AmpR
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(7361..7465)
                     /gene="bla"
                     /label=AmpR promoter

This page is informational only.