Cart 2

P[acman]-CmR-F-2 vector (V001817#)

Basic Vector Information

Basic Vector Information
Vector Name P[acman]-CmR-F-2 Antibiotic Resistance Chloramphenicol
Length 12257 bp Type BAC cloning vector
Source Venken KJ, He Y, Hoskins RA, Bellen HJ.

P[acman]-CmR-F-2 vector Vector Map

amplifiable BAC backbone P element 3' end M13 fwd T7 promoter multiple cloning site T3 promoter white dominant eye marker P element 5' end

P[acman]-CmR-F-2 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported               12257 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  BAC cloning vector P[acman]-CmR-F-2, complete sequence.
ACCESSION   EF106977
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 12257)
  AUTHORS   Venken KJ, He Y, Hoskins RA, Bellen HJ.
  TITLE     P[acman]: a BAC transgenic platform for targeted insertion of large 
            DNA fragments in D. melanogaster
  JOURNAL   Science 314 (5806), 1747-1751 (2006)
  PUBMED    17138868
REFERENCE   2  (bases 1 to 12257)
  AUTHORS   Venken KJT., He Y, Hoskins RA, Bellen HJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-NOV-2006) Molecular and Human Genetics, Baylor College
            of Medicine, One Baylor Plaza, Houston, TX 77030, USA
REFERENCE   3  (bases 1 to 12257)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..12257
                     /organism="BAC cloning vector P[acman]-CmR-F-2"
                     /mol_type="other DNA"
                     /note="available from the Drosophila Genomics Resource 
                     Center: http://dgrc.cgb.indiana.edu/"
                     /db_xref="taxon:412168"
     misc_feature    1..7118
                     /label=amplifiable BAC backbone
                     /note="amplifiable BAC backbone"
     misc_feature    244..717
                     /gene="sopC"
                     /label=sopC
                     /note="centromere-like partitioning region of the bacterial
                     F plasmid"
     CDS             complement(790..1761)
                     /codon_start=1
                     /gene="sopB"
                     /product="partitioning protein for the bacterial F plasmid"
                     /label=sopB
                     /translation="MKRAPVIPKHTLNTQPVEDTSLSTPAAPMVDSLIARVGVMARGNA
                     ITLPVCGRDVKFTLEVLRGDSVEKTSRVWSGNERDQELLTEDALDDLIPSFLLTGQQTP
                     AFGRRVSGVIEIADGSRRRKAAALTESDYRVLVGELDDEQMAALSRLGNDYRPTSAYER
                     GQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGD
                     ALQKAFTDKEELLKQQASNLHEQKKAGVIFEAEEVITLLTSVLKTSSASRTSLSSRHQF
                     APGATVLYKGDKMVLNLDRSRVPTECIEKIEAILKELEKPAP"
     CDS             complement(1761..2936)
                     /codon_start=1
                     /gene="sopA"
                     /product="partitioning protein for the bacterial F plasmid"
                     /label=sopA
                     /translation="MFRMKLMETLNQCINAGHEMTKAIAIAQFNDDSPEARKITRRWRI
                     GEAADLVGVSSQAIRDAEKAGRLPHPDMEIRGRVEQRVGYTIEQINHMRDVFGTRLRRA
                     EDVFPPVIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDL
                     HIHAEDTLLPFYLGEKDDVTYAIKPTCWPGLDIIPSCLALHRIETELMGKFDEGKLPTD
                     PHLMLRLAIETVAHDYDVIVIDSAPNLGIGTINVVCAADVLIVPTPAELFDYTSALQFF
                     DMLRDLLKNVDLKGFEPDVRILLTKYSNSNGSQSPWMEEQIRDAWGSMVLKNVVRETDE
                     VGKGQIRMRTVFEQAIDQRSSTGAWRNALSIWEPVCNEIFDRLIKPRWEIR"
     misc_feature    3262..3512
                     /gene="incC"
                     /label=incC
                     /note="incompatibility region of the bacterial F plasmid"
     CDS             complement(3515..4270)
                     /codon_start=1
                     /gene="repE"
                     /product="replication initiation protein for the bacterial 
                     F plasmid"
                     /label=repE
                     /translation="MAETAVINHKKRKNSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQ
                     IRKSDGTLQEHDGICEIHVAKYAEIFGLTSAEASKDIRQALKSFAGKEVVFYRPEEDAG
                     DEKGYESFPWFIKRAHSPSRGLYSVHINPYLIPFFIGLQNRFTQFRLSETKEITNPYAM
                     RLYESLCQYRKPDGSGIVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPM
                     RLSYIEKKKGRQTTHIVFSFRDITSMTTG"
     rep_origin      4361..4580
                     /label=ori2
                     /note="secondary origin of replication for the bacterial F 
                     plasmid; also known as oriS"
     rep_origin      4680..5296
                     /label=OriV
                     /note="OriV"
     rep_origin      4680..5294
                     /label=oriV
                     /note="origin of replication for the bacterial F plasmid"
     rep_origin      4771..5302
                     /label=oriV
                     /note="incP origin of replication"
     promoter        6236..6338
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding 
                     chloramphenicol acetyltransferase"
     CDS             6339..6998
                     /codon_start=1
                     /product="chloramphenicol acetyltransferase"
                     /label=chloramphenicol acetyltransferase
                     /protein_id="ABK59031.1"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     misc_feature    7129..7382
                     /label=P element 3' end
                     /note="P element 3' end"
     misc_feature    7150..7382
                     /label=P element 3' end
                     /note="P element 3' end"
     primer_bind     7389..7405
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        7415..7433
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     misc_feature    7477..7551
                     /label=multiple cloning site
                     /note="multiple cloning site"
     promoter        complement(7570..7588)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     misc_feature    7624..11639
                     /label=white dominant eye marker
                     /note="white dominant eye marker"
     CDS             join(8108..8179,8581..8854,8929..9583,9645..9960,
                     10164..10295,10366..10980)
                     /codon_start=1
                     /gene="white"
                     /product="Drosophila white gene eye color pigment"
                     /label=mini-white
                     /note="This is a modified version of the white gene lacking
                     part of the first intron."
                     /translation="MGQEDQELLIRGGSKHPSAEHLNNGDSGAASQSCINQGFGQAKNY
                     GTLRPPSPPEDSGSGSGQLAENLTYAWHNMDIFGAVNQPGSGWRQLVNRTRGLFCNERH
                     IPAPRKHLLKNVCGVAYPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRLLNG
                     QPVDAKEMQARCAYVQQDDLFIGSLTAREHLIFQAMVRMPRHLTYRQRVARVDQVIQEL
                     SLSKCQHTIIGVPGRVKGLSGGERKRLAFASEALTDPPLLICDEPTSGLDSFTAHSVVQ
                     VLKKLSQKGKTVILTIHQPSSELFELFDKILLMAEGRVAFLGTPSEAVDFFSYVGAQCP
                     TNYNPADFYVQVLAVVPGREIESRDRIAKICDNFAISKVARDMEQLLATKNLEKPLEQP
                     ENGYTYKATWFMQFRAVLWRSWLSVLKEPLLVKVRLIQTTMVAILIGLIFLGQQLTQVG
                     VMNINGAIFLFLTNMTFQNVFATINVFTSELPVFMREARSRLYRCDTYFLGKTIAELPL
                     FLTVPLVFTAIAYPMIGLRAGVLHFFNCLALVTLVANVSTSFGYLISCASSSTSMALSV
                     GPPVIIPFLLFGGFFLNSGSVPVYLKWLSYLSWFRYANEGLLINQWADVEPGEISCTSS
                     NTTCPSSGKVILETLNFSAADLPLDYVGLAILIVSFRVLAYLALRLRARRKE"
     misc_feature    11640..12246
                     /label=P element 5' end
                     /note="P element 5' end"
     misc_feature    11640..12225
                     /label=P element 5' end

This page is informational only.