pwFRT-pheS-gat vector (Cat. No.: V002137)
Basic Information
- Name:
- pwFRT-pheS-gat
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4531 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Kang Y, Norris MH, Hoang TT.
pwFRT-pheS-gat vector (Cat. No.: V002137) Sequence
LOCUS V002137 4531 bp DNA circular SYN 18-DEC-2018
DEFINITION Exported.
ACCESSION V002137
VERSION V002137
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 4531)
AUTHORS Kang Y, Norris MH, Hoang TT.
TITLE Knock-out and pull-out recombineering protocols for natural
transformable Burkholderia thailandensis and Burkholderia
pseudomallei
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 4531)
AUTHORS Kang Y, Norris MH, Hoang TT.
TITLE Direct Submission
JOURNAL Submitted (09-OCT-2009) Molecular Biosciences and Biological
Engineering, University of Hawaii at Manoa, 2538 McCarthy Mall,
Snyder Hall 207, Honolulu, HI 96822, USA
REFERENCE 3 (bases 1 to 4531)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4531)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(09-OCT-2009) Molecular Biosciences and Biological Engineering,
University of Hawaii at Manoa, 2538 McCarthy Mall, Snyder Hall 207,
Honolulu, HI 96822, USA"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4531
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 96..200
/label="AmpR promoter"
CDS 201..1058
/label="AmpR"
/note="beta-lactamase"
rep_origin 1232..1820
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 2108..2129
/label="CAP binding site"
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 2144..2174
/label="lac promoter"
/note="promoter for the E. coli lac operon"
protein_bind 2182..2198
/label="lac operator"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 2206..2222
/label="M13 rev"
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 2289..2356
/note="wild type FRT; Flp recognition target"
protein_bind complement(2306..2353)
/label="FRT"
/bound_moiety="FLP recombinase from the Saccharomyces
cerevisiae 2u plasmid"
/note="FLP-mediated recombination occurs in the 8-bp core
sequence TCTAGAAA (Turan and Bode, 2011)."
regulatory 2393..2434
/note="PCS12; rpsL promoter from Burkholderia cenocepacia"
/regulatory_class="promoter"
RBS 2445..2467
/label="RBS"
/note="efficient ribosome binding site from bacteriophage
T7 gene 10 (Olins and Rangwala, 1989)"
CDS 2478..3488
/gene="pheS"
/label="Phenylalanine--tRNA ligase alpha subunit"
/note="Phenylalanine--tRNA ligase alpha subunit from
Burkholderia pseudomallei (strain 1710b). Accession#:
Q3JT08"
CDS 3527..3967
/codon_start=1
/gene="gat"
/product="glyphosate acetyl transferase"
/label="gat"
/note="confers resistance to glyphosate"
/protein_id="ADO63837.1"
/translation="MIEVKPINAEDTYDLRHRVLRPNQPIEACMFESDLTRSAFHLGGF
YGGKLISVASFHQAEHSELQGKKQYQLRGVATLEGYREQKAGSSLVKHAEEILRKRGAD
MIWCNARTSASGYYRKLGFSEQGEVFDTPPVGPHILMYKRIT"
gene 3527..3967
/gene="gat"
/label="gat"
protein_bind complement(4023..4070)
/label="FRT"
/note="FLP-mediated recombination occurs in the 8-bp core
sequence TCTAGAAA (Turan and Bode, 2011)."
primer_bind complement(4137..4153)
/label="M13 fwd"
/note="common sequencing primer, one of multiple similar
variants"
This page is informational only.