pwFRT-PCS12-gat-sacB vector (Cat. No.: V002139)
Basic Information
- Name:
- pwFRT-PCS12-gat-sacB
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5092 bp
- Type:
- Gene replacement vector
- Replication origin:
- ori
- Source/Author:
- Kang Y, Norris MH, Wilcox BA, Hoang T.
pwFRT-PCS12-gat-sacB vector (Cat. No.: V002139) Sequence
LOCUS 40924_46528 5092 bp DNA circular SYN 18-DEC-2018
DEFINITION Gene replacement vector pwFRT-PCS12-gat-sacB, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5092)
AUTHORS Kang Y, Norris MH, Wilcox BA, Hoang T.
TITLE Knock-out and pull-out recombineering protocols for naturally
transformable Burkholderia thailandensis and Burkholderia
pseudomallei
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 5092)
AUTHORS Kang Y, Norris MH, Wilcox BA, Hoang T.
TITLE Direct Submission
JOURNAL Submitted (09-JAN-2010) Molecular Biosciences and Bioengineering,
University of Hawaii at Manoa, 2538 McCarthy Mall, Snyder Hall 207,
Honolulu, HI 96822, USA
REFERENCE 3 (bases 1 to 5092)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5092)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(09-JAN-2010) Molecular Biosciences and Bioengineering, University
of Hawaii at Manoa, 2538 McCarthy Mall, Snyder Hall 207, Honolulu,
HI 96822, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5092
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 96..200
/label=AmpR promoter
CDS 201..1058
/label=AmpR
/note="beta-lactamase"
rep_origin 1232..1820
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 2108..2129
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 2144..2174
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 2182..2198
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 2206..2222
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
misc_recomb 2289..2356
/note="FRT; flp recognition target"
protein_bind complement(2306..2353)
/label=FRT
/bound_moiety="FLP recombinase from the Saccharomyces
cerevisiae 2u plasmid"
/note="FLP-mediated recombination occurs in the 8-bp core
sequence TCTAGAAA (Turan and Bode, 2011)."
regulatory 2393..2434
/note="PCS12; Burkholderia cenocepacia rpsL promoter"
/regulatory_class="promoter"
RBS 2445..2467
/label=RBS
/note="efficient ribosome binding site from bacteriophage
T7 gene 10 (Olins and Rangwala, 1989)"
CDS 2503..2943
/codon_start=1
/gene="gat"
/product="glyphosate acetyl transferase"
/label=gat
/note="Gat; confers resistance to glyphosate"
/protein_id="ADD38967.1"
/translation="MIEVKPINAEDTYDLRHRVLRPNQPIEACMFESDLTRSAFHLGGF
YGGKLISVASFHQAEHSELQGKKQYQLRGVATLEGYREQKAGSSLVKHAEEILRKRGAD
MIWCNARTSASGYYRKLGFSEQGEVFDTPPVGPHILMYKRIT"
gene 2503..2943
/gene="gat"
/label=gat
CDS 3105..4457
/label=SacB
/note="secreted levansucrase that renders bacterial growth
sensitive to sucrose"
terminator complement(4474..4517)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
protein_bind complement(4584..4631)
/label=FRT
/note="FLP-mediated recombination occurs in the 8-bp core
sequence TCTAGAAA (Turan and Bode, 2011)."
primer_bind complement(4698..4714)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
This page is informational only.