Basic Vector Information
pVR37 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pVR37 vector Sequence
LOCUS 40924_46108 12588 bp DNA circular SYN 18-DEC-2018 DEFINITION Promoter probe vector pVR37, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 12588) AUTHORS Medi VG, Bhat RS, Kuruvinashetti MS. TITLE Promoter-probe vector with synthetic xylanase reporter JOURNAL Unpublished REFERENCE 2 (bases 1 to 12588) AUTHORS Medi VG, Bhat RS, Kuruvinashetti MS. TITLE Direct Submission JOURNAL Submitted (20-MAY-2008) Department of Biotechnology, University of Agricultural Sciences, Dharwad, Karnataka 580 005, India REFERENCE 3 (bases 1 to 12588) TITLE Direct Submission REFERENCE 4 (bases 1 to 12588) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (20-MAY-2008) Department of Biotechnology, University of Agricultural Sciences, Dharwad, Karnataka 580 005, India" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..12588 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind complement(39..55) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 432..777 /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" intron 809..998 /label=cat1 intron /note="castor bean catalase intron, modified" CDS 993..2816 /label=GUSPlus(TM) /note="beta-glucuronidase" CDS 2823..2840 /label=6xHis /note="6xHis affinity tag" terminator 2872..3124 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" misc_feature 3146..3170 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" CDS 4470..5096 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS 5533..6597 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" rep_origin 6666..6860 /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" misc_feature 7204..7344 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(7530..8118) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(8208..8999) /label=KanR /note="aminoglycoside phosphotransferase" misc_feature 9424..9448 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" polyA_signal complement(9526..9700) /label=CaMV poly(A) signal /note="cauliflower mosaic virus polyadenylation signal" CDS complement(9743..10765) /label=HygR /note="aminoglycoside phosphotransferase from E. coli" promoter complement(10833..11510) /label=CaMV 35S promoter (enhanced) /note="cauliflower mosaic virus 35S promoter with a duplicated enhancer region" protein_bind 11701..11722 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 11737..11767 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 11775..11791 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 11799..11815 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS complement(11846..12559) /codon_start=1 /product="xylanase A" /label=xylanase A /note="derived from Neocallimastix patriciarum" /protein_id="ACE77059.1" /translation="MASNGKKFTVGNGQNQHKGVNDGFSYEIWLDNTGGNGSMTLGSGA TFKAEWNAAVNRGNFLARRGLDFGSQKKATDYDYIGLDYAATYKQTASASGNSRLCVYG WFQNRGLNGVPLVEYYIIEDWVDWVPDAQGKMVTIDGAQYKIFQMDHTGPTINGGSETF KQYFSVRQQKRTSGHITVSDHFKEWAKQGWGIGNLYEVALNAEGWQSSGVADVTLLDVY TTPKGSSPATSAAPR" 5'UTR complement(12560..12587)
This page is informational only.