Basic Vector Information
- Vector Name:
- pVMExp14367
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6093 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Verma V, Kaur C, Grover P, Gupta A, Chaudhary VK.
- Promoter:
- sacB
pVMExp14367 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pVMExp14367 vector Sequence
LOCUS 40924_46033 6093 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pVMExp14367, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6093) AUTHORS Verma V, Kaur C, Grover P, Gupta A, Chaudhary VK. TITLE Biotin-tagged proteins: Reagents for efficient ELISA-based serodiagnosis and phage display-based affinity selection JOURNAL PLoS ONE 13 (1), e0191315 (2018) PUBMED 29360877 REFERENCE 2 (bases 1 to 6093) AUTHORS Chaudhary VK, Gupta A, Verma V, Kaur C, Grover P. TITLE Direct Submission JOURNAL Submitted (02-DEC-2017) Centre for Innovation in Infectious Disease Research, Education, and Training, University of Delhi South Campus, Benito Juarez Road, New Delhi, New Delhi 110021, India REFERENCE 3 (bases 1 to 6093) TITLE Direct Submission REFERENCE 4 (bases 1 to 6093) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2018"; volume: "13"; issue: "1"; pages: "e0191315" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-DEC-2017) Centre for Innovation in Infectious Disease Research, Education, and Training, University of Delhi South Campus, Benito Juarez Road, New Delhi, New Delhi 110021, India" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6093 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 1..19 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 20..44 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 59..81 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 98..124 /codon_start=1 /label=9xHis /note="9xHis affinity tag" /translation="HHHHHHHHH" CDS 143..163 /codon_start=1 /label=TEV site /note="tobacco etch virus (TEV) protease recognition and cleavage site" /translation="ENLYFQG" misc_feature complement(169..179) /label=BsaI-5' cloning site /note="BsaI-5' cloning site" promoter 180..625 /label=sacB promoter /note="sacB promoter and control region" CDS 626..2044 /codon_start=1 /label=SacB /note="secreted levansucrase that renders bacterial growth sensitive to sucrose" /translation="MNIKKFAKQATVLTFTTALLAGGATQAFAKETNQKPYKETYGISH ITRHDMLQIPEQQKNEKYQVPEFDSSTIKNISSAKGLDVWDSWPLQNADGTVANYHGYH IVFALAGDPKNADDTSIYMFYQKVGETSIDSWKNAGRVFKDSDKFDANDSILKDQTQEW SGSATFTSDGKIRLFYTDFSGKHYGKQTLTTAQVNVSASDSSLNINGVEDYKSIFDGDG KTYQNVQQFIDEGNYSSGDNHTLRDPHYVEDKGHKYLVFEANTGTEDGYQGEESLFNKA YYGKSTSFFRQESQKLLQSDKKRTAELANGALGMIELNDDYTLKKVMKPLIASNTVTDE IERANVFKMNGKWYLFTDSRGSKMTIDGITSNDIYMLGYVSNSLTGPYKPLNKTGLVLK MDLDPNDVTFTYSHFAVPQAKGNNVVITSYMTNRGFYADKQSTFAPSFLLNIKGKKTSV VKDSILEQGQLTVNK" misc_feature 2084..2094 /label=BsaI-3' cloning site /note="BsaI-3' cloning site" misc_feature 2091..2117 /label=spacer /note="spacer" CDS 2118..2162 /codon_start=1 /label=AviTag(TM) /note="peptide tag that allows for enzymatic biotinylation" /translation="GLNDIFEAQKIEWHE" terminator 2230..2277 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" rep_origin 2314..2769 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2796..2900 /label=AmpR promoter CDS 2901..3758 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 3932..4520 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind complement(4591..4612) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(4628..5707) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(5708..5785) /label=lacI promoter
This page is informational only.