Basic Vector Information
pVC7N vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pVC7N vector Sequence
LOCUS 40924_45903 6679 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pVC7N DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6679) AUTHORS Hashiro S, Yasueda H. TITLE High copy number mutants derived from Corynebacterium glutamicum cryptic plasmid pAM330 and copy number control JOURNAL Unpublished REFERENCE 2 (bases 1 to 6679) AUTHORS Hashiro S, Yasueda H. TITLE Direct Submission JOURNAL Submitted (19-SEP-2018) Contact:Shuhei Hashiro AJINOMOTO CO., INC., Frontier Research Labs. Institute For Innovation; 1-1 Suzuki-Cho, Kawasaki-Ku, Kawasaki, Kanagawa 210-8681, Japan URL :http://www.ajinomoto.com/ REFERENCE 3 (bases 1 to 6679) TITLE Direct Submission REFERENCE 4 (bases 1 to 6679) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (19-SEP-2018) Contact:Shuhei Hashiro AJINOMOTO CO., INC., Frontier Research Labs. Institute For Innovation; 1-1 Suzuki-Cho, Kawasaki-Ku, Kawasaki, Kanagawa 210-8681, Japan URL :http://www.ajinomoto.com/" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6679 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..4451 /label=pAM330N region /note="pAM330N region" CDS 1215..2600 /codon_start=1 /gene="repA" /label=repA /protein_id="BBG56731.1" /translation="MTTIALAKTTGTTPAQTRTAQPRTTSGLGNTEIEVNTSKEPQVNE GSKVTRARAWRRQNVMYKITNSKALAGCHRWRRDEAVAVSWSSNGASQFEGLQNSHSRW GSPLAELEVMGERRIELAIATKNHLAAGGALMMFVGTVRHNRSQSFAQVEAGIKTAYSS MVKTSQWKKERARYGVEHTYSDYEVTDSWANGWHLHRNMLLFLDRPLSDDELKAFEDSM FSRWSAGVVKAGMDAPLREHGVKLDQVSTWGGDAAKMATYLAKGMSQELTGSATKTASK GSYTPFQMLDMLADQSDAGEDMDAVLVARWREYEVGSKNLRSSWSRGAKRALGIDYIDA DVRREMEEELYKLAGLEAPERVESTRVAVALVKPDDWKLIQSDFAVRQYVLDCVDKAKD VAAAQRVANEVLASLGVDSTPCMIVMDDVDLDAVLPTHGDATKRDLNAAVFAGNEQTIL RTH" gene 1215..2600 /gene="repA" /label=repA CDS 4545..5201 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" protein_bind 5413..5434 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 5449..5479 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 5487..5503 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 5511..5527 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" misc_feature complement(5540..5596) /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(5597..5613) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin complement(5939..6527) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.