pVALIUM10 vector (Cat. No.: V002253)
Basic Information
- Name:
- pVALIUM10
- Antibiotic Resistance:
- Ampicillin
- Length:
- 11143 bp
- Type:
- RNAi cloning vector
- Replication origin:
- ori
- Source/Author:
- Ni J-Q., Liu L-P., Perkins LA, Perrimon N.
- Promoter:
- hsp70
pVALIUM10 vector (Cat. No.: V002253) Sequence
LOCUS 40924_45888 11143 bp DNA circular SYN 18-DEC-2018
DEFINITION RNAi cloning vector pVALIUM10, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 11143)
AUTHORS Ni J-Q., Liu L-P., Perkins LA, Perrimon N.
TITLE Vectors for transgenic flies
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 11143)
AUTHORS Ni J-Q., Liu L-P., Perkins LA, Perrimon N.
TITLE Direct Submission
JOURNAL Submitted (02-FEB-2010) Genetics, Harvard Medical School, 77 Avenue
Louis Pasteur, Boston, MA 02115, USA
REFERENCE 3 (bases 1 to 11143)
AUTHORS Hu Y, Perkins LA.
TITLE Direct Submission
JOURNAL Submitted (20-JUN-2012) Genetics, Harvard Medical School, 77 Avenue
Louis Pasteur, Boston, MA 02115, USA
REFERENCE 4 (bases 1 to 11143)
TITLE Direct Submission
REFERENCE 5 (bases 1 to 11143)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(02-FEB-2010) Genetics, Harvard Medical School, 77 Avenue Louis
Pasteur, Boston, MA 02115, USA"
COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
(20-JUN-2012) Genetics, Harvard Medical School, 77 Avenue Louis
Pasteur, Boston, MA 02115, USA"
COMMENT SGRef: number: 4; type: "Journal Article"
COMMENT On Jun 20, 2012 this sequence version replaced GU931382.1.
FEATURES Location/Qualifiers
source 1..11143
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin complement(6..461)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 603..619
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 626..644
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
misc_feature 664..2543
/label=vermilion
/note="vermilion"
CDS complement(join(834..951,1028..1121,1213..1819,1874..2007,
2068..2228,2302..2327))
/codon_start=1
/product="vermillion"
/label=vermillion
/note="selectable marker"
/protein_id="ADE08344.1"
/translation="MSCPYAGNGNDHDDSAVPLTTEVGKIYGEYLMLDKLLDAQCMLSE
EDKRPVHDEHLFIITHQAYELWFKQIIFEFDSIRDMLDAEVIDETKTLEIVKRLNRVVL
ILKLLVDQVPILETMTPLDFMDFRKYLAPASGFQSLQFRLIENKLGVLTEQRVRYNQKY
SDVFSDEEARNSIRNSEKDPSLLELVQRWLERTPGLEESGFNFWAKFQESVDRFLEAQV
QSAMEEPVEKAKNYRLMDIEKRREVYRSIFDPAVHDALVRRGDRRFSHRALQGAIMITF
YRDEPRFSQPHQLLTLLMDIDSLITKWRYNHVIMVQRMIGSQQLGTGGSSGYQYLRSTL
SDRYKVFLDLFNLSTFLIPREAIPPLDETIRKKLINKSV"
protein_bind 2640..2709
/label=attB
/note="attB site for the phi-C31 integrase (Groth et al.,
2000)"
protein_bind 2947..3377
/label=gypsy insulator
/note="chromatin insulator from Drosophila"
protein_bind 3395..3428
/label=loxP
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (ATGTATGC) (Shaw et al., 2021)."
protein_bind 3441..3535
/label=5X UAS
/note="five tandem copies of the 'ScaI site' 17-mer
CGGAGTACTGTCCTCCG, an upstream activating sequence (UAS)
that efficiently binds yeast Gal4 (Webster et al., 1988;
Pfeiffer et al., 2010)"
misc_recomb 3551..3584
/label=LoxP
/note="LoxP"
protein_bind complement(3551..3584)
/label=loxP
/bound_moiety="Cre recombinase"
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (GCATACAT)."
misc_feature 3591..3700
/label=5XUAS
/note="5XUAS"
protein_bind 3597..3691
/label=5X UAS
/bound_moiety="GAL4"
/note="five tandem copies of the ""ScaI site"" 17-mer
CGGAGTACTGTCCTCCG, an upstream activating sequence (UAS)
that efficiently binds yeast Gal4 (Webster et al., 1988;
Pfeiffer et al., 2010)"
promoter 3715..3953
/label=hsp70 promoter
/note="Drosophila melanogaster hsp70Bb promoter"
protein_bind 3998..4122
/label=attR1
/note="recombination site for the Gateway(R) LR reaction"
promoter 4147..4177
/label=lac UV5 promoter
/note="E. coli lac promoter with an 'up' mutation"
CDS 4231..4887
/label=CmR
/note="chloramphenicol acetyltransferase"
CDS 5232..5534
/label=ccdB
/note="CcdB, a bacterial toxin that poisons DNA gyrase"
protein_bind complement(5578..5702)
/label=attR2
/note="recombination site for the Gateway(R) LR reaction"
intron 5725..5871
/note="ftz intron"
protein_bind 5882..6006
/label=attR2
/note="recombination site for the Gateway(R) LR reaction"
CDS complement(6050..6352)
/label=ccdB
/note="CcdB, a bacterial toxin that poisons DNA gyrase"
CDS complement(6697..7353)
/label=CmR
/note="chloramphenicol acetyltransferase"
promoter complement(7407..7437)
/label=lac UV5 promoter
/note="E. coli lac promoter with an 'up' mutation"
protein_bind complement(7462..7586)
/label=attR1
/note="recombination site for the Gateway(R) LR reaction"
intron 7633..7779
/note="ftz intron"
intron 7879..7944
/label=small t intron
/note="SV40 (simian virus 40) small t antigen intron"
CDS 8074..8094
/label=SV40 NLS
/note="nuclear localization signal of SV40 (simian virus
40) large T antigen"
polyA_signal 8366..8500
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
protein_bind 8513..8898
/label=gypsy insulator
/note="chromatin insulator from Drosophila"
promoter complement(8958..8976)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(8997..9013)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 9021..9037
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(9045..9075)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(9090..9111)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(9399..9987)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(10161..11018)
/label=AmpR
/note="beta-lactamase"
promoter complement(11019..11123)
/label=AmpR promoter
This page is informational only.