Basic Vector Information
- Vector Name:
- pVALIUM10
- Antibiotic Resistance:
- Ampicillin
- Length:
- 11143 bp
- Type:
- RNAi cloning vector
- Replication origin:
- ori
- Source/Author:
- Ni J-Q., Liu L-P., Perkins LA, Perrimon N.
- Promoter:
- hsp70
pVALIUM10 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pVALIUM10 vector Sequence
LOCUS 40924_45888 11143 bp DNA circular SYN 18-DEC-2018 DEFINITION RNAi cloning vector pVALIUM10, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11143) AUTHORS Ni J-Q., Liu L-P., Perkins LA, Perrimon N. TITLE Vectors for transgenic flies JOURNAL Unpublished REFERENCE 2 (bases 1 to 11143) AUTHORS Ni J-Q., Liu L-P., Perkins LA, Perrimon N. TITLE Direct Submission JOURNAL Submitted (02-FEB-2010) Genetics, Harvard Medical School, 77 Avenue Louis Pasteur, Boston, MA 02115, USA REFERENCE 3 (bases 1 to 11143) AUTHORS Hu Y, Perkins LA. TITLE Direct Submission JOURNAL Submitted (20-JUN-2012) Genetics, Harvard Medical School, 77 Avenue Louis Pasteur, Boston, MA 02115, USA REFERENCE 4 (bases 1 to 11143) TITLE Direct Submission REFERENCE 5 (bases 1 to 11143) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2010) Genetics, Harvard Medical School, 77 Avenue Louis Pasteur, Boston, MA 02115, USA" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (20-JUN-2012) Genetics, Harvard Medical School, 77 Avenue Louis Pasteur, Boston, MA 02115, USA" COMMENT SGRef: number: 4; type: "Journal Article" COMMENT On Jun 20, 2012 this sequence version replaced GU931382.1. FEATURES Location/Qualifiers source 1..11143 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(6..461) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 603..619 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 626..644 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature 664..2543 /label=vermilion /note="vermilion" CDS complement(join(834..951,1028..1121,1213..1819,1874..2007, 2068..2228,2302..2327)) /codon_start=1 /product="vermillion" /label=vermillion /note="selectable marker" /protein_id="ADE08344.1" /translation="MSCPYAGNGNDHDDSAVPLTTEVGKIYGEYLMLDKLLDAQCMLSE EDKRPVHDEHLFIITHQAYELWFKQIIFEFDSIRDMLDAEVIDETKTLEIVKRLNRVVL ILKLLVDQVPILETMTPLDFMDFRKYLAPASGFQSLQFRLIENKLGVLTEQRVRYNQKY SDVFSDEEARNSIRNSEKDPSLLELVQRWLERTPGLEESGFNFWAKFQESVDRFLEAQV QSAMEEPVEKAKNYRLMDIEKRREVYRSIFDPAVHDALVRRGDRRFSHRALQGAIMITF YRDEPRFSQPHQLLTLLMDIDSLITKWRYNHVIMVQRMIGSQQLGTGGSSGYQYLRSTL SDRYKVFLDLFNLSTFLIPREAIPPLDETIRKKLINKSV" protein_bind 2640..2709 /label=attB /note="attB site for the phi-C31 integrase (Groth et al., 2000)" protein_bind 2947..3377 /label=gypsy insulator /note="chromatin insulator from Drosophila" protein_bind 3395..3428 /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." protein_bind 3441..3535 /label=5X UAS /note="five tandem copies of the 'ScaI site' 17-mer CGGAGTACTGTCCTCCG, an upstream activating sequence (UAS) that efficiently binds yeast Gal4 (Webster et al., 1988; Pfeiffer et al., 2010)" misc_recomb 3551..3584 /label=LoxP /note="LoxP" protein_bind complement(3551..3584) /label=loxP /bound_moiety="Cre recombinase" /note="Cre-mediated recombination occurs in the 8-bp core sequence (GCATACAT)." misc_feature 3591..3700 /label=5XUAS /note="5XUAS" protein_bind 3597..3691 /label=5X UAS /bound_moiety="GAL4" /note="five tandem copies of the ""ScaI site"" 17-mer CGGAGTACTGTCCTCCG, an upstream activating sequence (UAS) that efficiently binds yeast Gal4 (Webster et al., 1988; Pfeiffer et al., 2010)" promoter 3715..3953 /label=hsp70 promoter /note="Drosophila melanogaster hsp70Bb promoter" protein_bind 3998..4122 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter 4147..4177 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" CDS 4231..4887 /label=CmR /note="chloramphenicol acetyltransferase" CDS 5232..5534 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" protein_bind complement(5578..5702) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" intron 5725..5871 /note="ftz intron" protein_bind 5882..6006 /label=attR2 /note="recombination site for the Gateway(R) LR reaction" CDS complement(6050..6352) /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" CDS complement(6697..7353) /label=CmR /note="chloramphenicol acetyltransferase" promoter complement(7407..7437) /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" protein_bind complement(7462..7586) /label=attR1 /note="recombination site for the Gateway(R) LR reaction" intron 7633..7779 /note="ftz intron" intron 7879..7944 /label=small t intron /note="SV40 (simian virus 40) small t antigen intron" CDS 8074..8094 /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" polyA_signal 8366..8500 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" protein_bind 8513..8898 /label=gypsy insulator /note="chromatin insulator from Drosophila" promoter complement(8958..8976) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(8997..9013) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind 9021..9037 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(9045..9075) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(9090..9111) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(9399..9987) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(10161..11018) /label=AmpR /note="beta-lactamase" promoter complement(11019..11123) /label=AmpR promoter
This page is informational only.