Basic Vector Information
pUT2 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pUT2 vector Sequence
LOCUS 40924_45813 6021 bp DNA circular SYN 18-DEC-2018
DEFINITION Expression vector pUT2 DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6021)
AUTHORS Kasai Y, Oshima K, Ikeda F, Abe J, Yoshimitsu Y, Harayama S.
TITLE Construction of self-cloning system in a unicellular green algae,
Pseudochoricystis ellipsoidea
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 6021)
AUTHORS Kasai Y, Oshima K, Ikeda F, Abe J, Yoshimitsu Y, Harayama S.
TITLE Direct Submission
JOURNAL Submitted (22-DEC-2014) Contact:Yuki Kasai Chuo University,
Biological Science; 1-13-27 Kasuga, Bunkyo-ku, Tokyo 112-8551, Japan
REFERENCE 3 (bases 1 to 6021)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6021)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(22-DEC-2014) Contact:Yuki Kasai Chuo University, Biological
Science; 1-13-27 Kasuga, Bunkyo-ku, Tokyo 112-8551, Japan"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6021
/mol_type="other DNA"
/organism="synthetic DNA construct"
regulatory 1..790
/note="includes promoter region of Pseudochoricystis
ellipsoidea nuclear gene RBCS for ribulose bisphosphate
carboxylase/oxygenase small subunit"
/regulatory_class="promoter"
misc_feature 795..1073
/note="include intron 1 of Pseudochoricystis ellipsoidea
nuclear gene RBCS for ribulose bisphosphate
carboxylase/oxygenase small subunit"
CDS 1076..2578
/codon_start=1
/gene="UMPS"
/product="uridine monophosphate synthase"
/label=UMPS
/protein_id="BAR90702.1"
/translation="MATSTPSVATAAELKPKEGPITSQEFEELVLRLHEIEAVKFGNFK
LKSGLMSPIYIDLRVIVSYPDVLRRVAEVMWHQVSGAAFDVMCGVPYTALPIATCMSLL
HGTPMLMRRKEVKEYGTKKAIEGAFKKGQTCLIVEDLVTSGASVMETVEPLEVEGLKVT
DVVVLIDREQGGAARMASNGLRLHSAFTLSFIIKTLQAHGLVSAKVADSVAAFIAANQT
FTPSAAAPTPSPAAPAQPKRLPFEERASLCQNAAGRKLLELMARKRTNLAVAADVATVE
EMLRIADAAGPHIAVFKTHVDIFDKWDDGIATQLRHLADKHEFLIFEDRKFADIGNTVV
SQYGGGIYKIADWSDITNAHLVPGPGIIDGLRKVGQEKGRGLLLLAEMSSKGALATGAY
TEKVAEAAAANQDFVMGFICQSPAKWATPVPPGLVHMTPGVQLASGSDALGQQYNTPAS
VIGQGGSDVIIVGRGIIKAADPAAAAAQYREAGWAAYEATLA"
gene 1076..2578
/gene="UMPS"
/label=UMPS
regulatory 2594..3111
/note="includes terminator region of Pseudochoricystis
ellipsoidea nuclear gene RBCS for ribulose bisphosphate
carboxylase/oxygenase small subunit"
/regulatory_class="terminator"
promoter complement(3145..3163)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(3184..3200)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(3208..3224)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(3232..3262)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(3277..3298)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(3586..4174)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(4348..5205)
/label=AmpR
/note="beta-lactamase"
promoter complement(5206..5310)
/label=AmpR promoter
rep_origin 5337..5792
/direction=RIGHT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 5933..5949
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 5959..5977
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
This page is informational only.