Basic Vector Information
- Vector Name:
- pUT1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6826 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Kasai Y, Oshima K, Ikeda F, Abe J, Yoshimitsu Y, Harayama S.
- Promoter:
- T3
pUT1 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pUT1 vector Sequence
LOCUS 40924_45808 6826 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pUT1 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6826) AUTHORS Kasai Y, Oshima K, Ikeda F, Abe J, Yoshimitsu Y, Harayama S. TITLE Construction of self-cloning system in a unicellular green algae, Pseudochoricystis ellipsoidea JOURNAL Unpublished REFERENCE 2 (bases 1 to 6826) AUTHORS Kasai Y, Oshima K, Ikeda F, Abe J, Yoshimitsu Y, Harayama S. TITLE Direct Submission JOURNAL Submitted (22-DEC-2014) Contact:Yuki Kasai Chuo University, Biological Science; 1-13-27 Kasuga, Bunkyo-ku, Tokyo 112-8551, Japan REFERENCE 3 (bases 1 to 6826) TITLE Direct Submission REFERENCE 4 (bases 1 to 6826) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (22-DEC-2014) Contact:Yuki Kasai Chuo University, Biological Science; 1-13-27 Kasuga, Bunkyo-ku, Tokyo 112-8551, Japan" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6826 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 5..960 /note="includes promoter region of Pseudochoricystis ellipsoidea beta-tubulin (TUBULIN1) gene" /regulatory_class="promoter" CDS 963..2465 /codon_start=1 /gene="UMPS" /product="uridine monophosphate synthase" /label=UMPS /protein_id="BAR90701.1" /translation="MATSTPSVATAAELKPKEGPITSQEFEELVLRLHEIEAVKFGNFK LKSGLMSPIYIDLRVIVSYPDVLRRVAEVMWHQVSGAAFDVMCGVPYTALPIATCMSLL HGTPMLMRRKEVKEYGTKKAIEGAFKKGQTCLIVEDLVTSGASVMETVEPLEVEGLKVT DVVVLIDREQGGAARMASNGLRLHSAFTLSFIIKTLQAHGLVSAKVADSVAAFIAANQT FTPSAAAPTPSPAAPAQPKRLPFEERASLCQNAAGRKLLELMARKRTNLAVAADVATVE EMLRIADAAGPHIAVFKTHVDIFDKWDDGIATQLRHLADKHEFLIFEDRKFADIGNTVV SQYGGGIYKIADWSDITNAHLVPGPGIIDGLRKVGQEKGRGLLLLAEMSSKGALATGAY TEKVAEAAAANQDFVMGFICQSPAKWATPVPPGLVHMTPGVQLASGSDALGQQYNTPAS VIGQGGSDVIIVGRGIIKAADPAAAAAQYREAGWAAYEATLA" gene 963..2465 /gene="UMPS" /label=UMPS regulatory 2463..3898 /note="includes terminator region of Pseudochoricystis ellipsoidea actin (ACTIN1) gene" /regulatory_class="terminator" promoter complement(3920..3938) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(3959..3975) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(3983..3999) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4007..4037) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4052..4073) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4361..4949) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5123..5980) /label=AmpR /note="beta-lactamase" promoter complement(5981..6085) /label=AmpR promoter rep_origin 6112..6567 /direction=RIGHT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 6708..6724 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 6734..6752 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 6785..6801 /label=SK primer /note="common sequencing primer, one of multiple similar variants"
This page is informational only.