pUT1 vector (V002270)

MSDS

Basic Vector Information

Vector Name:: pUT1

Antibiotic Resistance:: Ampicillin

Length:: 6826 bp

Type:: Expression vector

Replication origin:: ori

Source/Author:: Kasai Y, Oshima K, Ikeda F, Abe J, Yoshimitsu Y, Harayama S.

Promoter:: T3

pUT1 vector Vector Map

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pUT1 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_45808        6826 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Expression vector pUT1 DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6826)
  AUTHORS   Kasai Y, Oshima K, Ikeda F, Abe J, Yoshimitsu Y, Harayama S.
  TITLE     Construction of self-cloning system in a unicellular green algae, 
            Pseudochoricystis ellipsoidea
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6826)
  AUTHORS   Kasai Y, Oshima K, Ikeda F, Abe J, Yoshimitsu Y, Harayama S.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-DEC-2014) Contact:Yuki Kasai Chuo University, 
            Biological Science; 1-13-27 Kasuga, Bunkyo-ku, Tokyo 112-8551, Japan
REFERENCE   3  (bases 1 to 6826)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6826)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (22-DEC-2014) Contact:Yuki Kasai Chuo University, Biological 
            Science; 1-13-27 Kasuga, Bunkyo-ku, Tokyo 112-8551, Japan"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6826
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      5..960
                     /note="includes promoter region of Pseudochoricystis
                     ellipsoidea beta-tubulin (TUBULIN1) gene"
                     /regulatory_class="promoter"
     CDS             963..2465
                     /codon_start=1
                     /gene="UMPS"
                     /product="uridine monophosphate synthase"
                     /label=UMPS
                     /protein_id="BAR90701.1"
                     /translation="MATSTPSVATAAELKPKEGPITSQEFEELVLRLHEIEAVKFGNFK
                     LKSGLMSPIYIDLRVIVSYPDVLRRVAEVMWHQVSGAAFDVMCGVPYTALPIATCMSLL
                     HGTPMLMRRKEVKEYGTKKAIEGAFKKGQTCLIVEDLVTSGASVMETVEPLEVEGLKVT
                     DVVVLIDREQGGAARMASNGLRLHSAFTLSFIIKTLQAHGLVSAKVADSVAAFIAANQT
                     FTPSAAAPTPSPAAPAQPKRLPFEERASLCQNAAGRKLLELMARKRTNLAVAADVATVE
                     EMLRIADAAGPHIAVFKTHVDIFDKWDDGIATQLRHLADKHEFLIFEDRKFADIGNTVV
                     SQYGGGIYKIADWSDITNAHLVPGPGIIDGLRKVGQEKGRGLLLLAEMSSKGALATGAY
                     TEKVAEAAAANQDFVMGFICQSPAKWATPVPPGLVHMTPGVQLASGSDALGQQYNTPAS
                     VIGQGGSDVIIVGRGIIKAADPAAAAAQYREAGWAAYEATLA"
     gene            963..2465
                     /gene="UMPS"
                     /label=UMPS
     regulatory      2463..3898
                     /note="includes terminator region of Pseudochoricystis 
                     ellipsoidea actin (ACTIN1) gene"
                     /regulatory_class="terminator"
     promoter        complement(3920..3938)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(3959..3975)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(3983..3999)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(4007..4037)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(4052..4073)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(4361..4949)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(5123..5980)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(5981..6085)
                     /label=AmpR promoter
     rep_origin      6112..6567
                     /direction=RIGHT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     6708..6724
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        6734..6752
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     6785..6801
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"

This page is informational only.