Basic Vector Information
pUCAG.MEF2C vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pUCAG.MEF2C vector Sequence
LOCUS 40924_45223 6382 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pUCAG.MEF2C, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6382) AUTHORS van Tuyn J, Pijnappels DA, de Vries AA, de Vries I, van der Velde-van Dijke I, Knaan-Shanzer S, van der Laarse A, Schalij MJ, Atsma DE. TITLE Fibroblasts from human postmyocardial infarction scars acquire properties of cardiomyocytes after transduction with a recombinant myocardin gene JOURNAL FASEB J. 21 (12), 3369-3379 (2007) PUBMED 17579192 REFERENCE 2 (bases 1 to 6382) AUTHORS van Tuyn J. TITLE Direct Submission JOURNAL Submitted (13-DEC-2006) MCB, LUMC, Einthovenweg 20, Leiden, ZH 2300 RC, Netherlands REFERENCE 3 (bases 1 to 6382) TITLE Direct Submission REFERENCE 4 (bases 1 to 6382) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "FASEB J."; date: "2007"; volume: "21"; issue: "12"; pages: "3369-3379" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-DEC-2006) MCB, LUMC, Einthovenweg 20, Leiden, ZH 2300 RC, Netherlands" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6382 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 1..17 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" regulatory 68..448 /label=CMV.IE enhancer /note="CMV.IE enhancer" /regulatory_class="enhancer" enhancer 68..447 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 450..725 /label=chicken beta-actin promoter intron 726..1734 /label=chimeric intron /note="chimera between introns from chicken beta-actin and rabbit beta-globin" CDS 1854..3155 /codon_start=1 /gene="MEF2C" /product="Homo sapiens MEF2C" /label=MEF2C /protein_id="ABM67540.1" /translation="MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIAL IIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDAD DSVGHSPESEDKYRKINEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLVYSNPVSS LGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNS PGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINNSQSAQ SLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVT GWQQQHLHNMPPSALSQLGDRTTTPSRYPQHTRHEAGRSPVDSLSSCSSSYDGSDREDH RNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT" gene 1854..3155 /gene="MEF2C" /label=MEF2C polyA_signal 3351..3406 /label=beta-globin poly(A) signal /note="rabbit beta-globin polyadenylation signal (Gil and Proudfoot, 1987)" primer_bind complement(3783..3799) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 4273..4377 /label=AmpR promoter CDS 4378..5235 /label=AmpR /note="beta-lactamase" rep_origin 5409..5997 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 6285..6306 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 6321..6351 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 6359..6375 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)."
This page is informational only.