pUCAG.MEF2C vector (V002387)

Basic Vector Information

      • Vector Name:
      • pUCAG.MEF2C
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 6382 bp
      • Type:
      • Shuttle vector
      • Source/Author:
      • van Tuyn J, Pijnappels DA, de Vries AA, de Vries I, van der Velde-van Dijke I, Knaan-Shanzer S, van der Laarse A, Schalij MJ, Atsma DE.

pUCAG.MEF2C vector Vector Map

pUCAG.MEF2C6382 bp300600900120015001800210024002700300033003600390042004500480051005400570060006300M13 revCMV.IE enhancerchicken beta-actin promoterchimeric intronMEF2Cbeta-globin poly(A) signalM13 fwdAmpR promoterAmpRoriCAP binding sitelac promoterlac operator

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pUCAG.MEF2C vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_45223        6382 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Shuttle vector pUCAG.MEF2C, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6382)
  AUTHORS   van Tuyn J, Pijnappels DA, de Vries AA, de Vries I, van der 
            Velde-van Dijke I, Knaan-Shanzer S, van der Laarse A, Schalij MJ, 
            Atsma DE.
  TITLE     Fibroblasts from human postmyocardial infarction scars acquire 
            properties of cardiomyocytes after transduction with a recombinant 
            myocardin gene
  JOURNAL   FASEB J. 21 (12), 3369-3379 (2007)
  PUBMED    17579192
REFERENCE   2  (bases 1 to 6382)
  AUTHORS   van Tuyn J.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2006) MCB, LUMC, Einthovenweg 20, Leiden, ZH 2300 
            RC, Netherlands
REFERENCE   3  (bases 1 to 6382)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6382)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "FASEB J."; 
            date: "2007"; volume: "21"; issue: "12"; pages: "3369-3379"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (13-DEC-2006) MCB, LUMC, Einthovenweg 20, Leiden, ZH 2300 RC, 
            Netherlands"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6382
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     1..17
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      68..448
                     /label=CMV.IE enhancer
                     /note="CMV.IE enhancer"
                     /regulatory_class="enhancer"
     enhancer        68..447
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        450..725
                     /label=chicken beta-actin promoter
     intron          726..1734
                     /label=chimeric intron
                     /note="chimera between introns from chicken beta-actin and
                     rabbit beta-globin"
     CDS             1854..3155
                     /codon_start=1
                     /gene="MEF2C"
                     /product="Homo sapiens MEF2C"
                     /label=MEF2C
                     /protein_id="ABM67540.1"
                     /translation="MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIAL
                     IIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDAD
                     DSVGHSPESEDKYRKINEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLVYSNPVSS
                     LGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNS
                     PGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINNSQSAQ
                     SLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVT
                     GWQQQHLHNMPPSALSQLGDRTTTPSRYPQHTRHEAGRSPVDSLSSCSSSYDGSDREDH
                     RNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT"
     gene            1854..3155
                     /gene="MEF2C"
                     /label=MEF2C
     polyA_signal    3351..3406
                     /label=beta-globin poly(A) signal
                     /note="rabbit beta-globin polyadenylation signal (Gil and 
                     Proudfoot, 1987)"
     primer_bind     complement(3783..3799)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        4273..4377
                     /label=AmpR promoter
     CDS             4378..5235
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      5409..5997
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     protein_bind    6285..6306
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        6321..6351
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    6359..6375
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

This page is informational only.