Basic Vector Information
- Vector Name:
- pUC18VcluxOR
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4186 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Kasai S.
pUC18VcluxOR vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pUC18VcluxOR vector Sequence
LOCUS 40924_45123 4186 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pUC18VcluxOR DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4186) AUTHORS Kasai S. TITLE Freshwater bioluminescence in Vibrio albensis (Vibrio cholerae biovar albensis) NCIMB 41 is caused by a two-nucleotide deletion in luxO JOURNAL J. Biochem. 139 (3), 471-482 (2006) PUBMED 16567412 REFERENCE 2 (bases 1 to 4186) AUTHORS Kasai S. TITLE Direct Submission JOURNAL Submitted (16-SEP-2005) Contact:Sabu Kasai Graduate School of Engineering, Osaka City University, Department of Applied Chemistry and Bioapplied Chemistry; Sugimoto 3-3-138, Sumiyoshi-ku, Osaka 558-8585, Japan REFERENCE 3 (bases 1 to 4186) TITLE Direct Submission REFERENCE 4 (bases 1 to 4186) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Biochem."; date: "2006"; volume: "139"; issue: "3"; pages: "471-482" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (16-SEP-2005) Contact:Sabu Kasai Graduate School of Engineering, Osaka City University, Department of Applied Chemistry and Bioapplied Chemistry; Sugimoto 3-3-138, Sumiyoshi-ku, Osaka 558-8585, Japan" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4186 /mol_type="other DNA" /organism="synthetic DNA construct" source 2259..3783 /strain="NCIMB 41" /mol_type="other DNA" /note="biovar:albensis; synonym: Vibrio cholerae bv. albensis" /db_xref="taxon:140100" /organism="Vibrio albensis" promoter 96..200 /label=AmpR promoter CDS 201..1058 /label=AmpR /note="beta-lactamase" rep_origin 1232..1820 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 2108..2129 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2144..2174 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 2182..2198 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 2206..2222 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 2412..3779 /codon_start=1 /gene="luxO" /product="LuxO" /label=luxO /note="derived from Vibrio cholerae biovar albensis lux0 gene, deposited in Acc# AB114423, a two nucleotide deletion is recoverd" /protein_id="BAE87124.1" /translation="MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLIL LDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSIDTAVEAMRHGTQDFLIKPCEADRL RVTVNNAIRKASKLKNDVDNKNQNYQGFIGSSQTMQAVSRTIDSAASSKASIFITGESG TGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEA ADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQ EGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAYSLLGFMSKEEGKDFVRLSAEVVERF RQYEWPGNVRQLQNVLRNVVVLNEGREITLDMLPPPLNQMSVPINRALPLAHENKVSVH EIFPLWMTEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKLQTWNEKVKEKEKER" gene 2412..3779 /gene="luxO" /label=luxO primer_bind complement(3792..3808) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants"
This page is informational only.