pUC-TTrepT vector (V002435)

LOCUS       40924_44928        5056 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pUC-TTrepT DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5056)
  AUTHORS   Vieira J, Messing J.
  TITLE     The pUC plasmids, an M13mp7-derived system for insertion mutagenesis
            and sequencing with synthetic universal primers
  JOURNAL   Gene 19 (3), 259-268 (1982)
  PUBMED    6295879
REFERENCE   2  (bases 1 to 5056)
  AUTHORS   Fujita A, Misumi Y, Koyama Y.
  TITLE     Two versatile shuttle vectors for Thermus thermophilus-Escherichia 
            coli containing multiple cloning sites, lacZalpha gene and kanamycin
            or hygromycin resistance marker
  JOURNAL   Plasmid 67 (3), 272-275 (2012)
  PUBMED    22252135
REFERENCE   3  (bases 1 to 5056)
  AUTHORS   Fujita A.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-SEP-2011) Contact:Atsushi Fujita National Institute of
            Advanced Science and Technology, Biomedical Research Institute; 
            1-1-1 Higashi, Tsukuba, Ibaraki 305-8566, Japan URL 
            :http://www.aist.go.jp/
REFERENCE   4  (bases 1 to 5056)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 5056)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Gene"; 
            date: "1982"; volume: "19"; issue: "3"; pages: "259-268"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Plasmid"; 
            date: "2012"; volume: "67"; issue: "3"; pages: "272-275"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (08-SEP-2011) Contact:Atsushi Fujita National Institute of Advanced 
            Science and Technology, Biomedical Research Institute; 1-1-1 
            Higashi, Tsukuba, Ibaraki 305-8566, Japan URL 
            :http://www.aist.go.jp/"
COMMENT     SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5056
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    106..127
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        142..172
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    180..196
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     204..220
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    233..283
                     /note="polylinker 
                     HindIII-NotI-SalI-NruI-AflII-EcoRV-Acc65I-EcoRI"
     primer_bind     complement(284..300)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    690..3062
                     /label=derived from pYK225 (derivative of pTT8)
                     /note="derived from pYK225 (derivative of pTT8)"
     CDS             complement(1197..2360)
                     /codon_start=1
                     /gene="repA"
                     /product="putative RepA protein"
                     /label=repA
                     /protein_id="BAL70402.1"
                     /translation="MVLRAYAALRGLSPEALRAHLLAPPLRPERAREAFQRPYLAHFAQ
                     TLPRYPYATDDPKEGVRIYKRENALKRVHVQVGHYPHAVLRLVVDVDLPWPQVEERIHA
                     LPPSLVLVNPRSGHFHAWYELDPIPLTPPPGREGSLKGALALLAEVEALLEAYYGADPG
                     YNGLLSRNPFLHPPEWTWGGGKRWSLRDLHRELRGLLPSGTRRRVDPGLASYGRNNALF
                     DRLRAEAYAHVALFRGVPGGEEAFRAWVEQRAHALNQSLFRDHPKGPLDPREVHHTAKS
                     VAKWTYRNYRGARVYPVSSTGRPDRSRLSPQARALIPPLQGQELQEAVREGGRRRGSRR
                     RQEAEEKLTEALKRLQARGERVTARALAREAGVKPHTASKWLKRMRE"
     gene            complement(1197..2360)
                     /gene="repA"
                     /label=repA
     promoter        3150..3254
                     /label=AmpR promoter
     CDS             3255..4112
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      4286..4874
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"