Basic Vector Information
pTSara* vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pTSara* vector Sequence
LOCUS 40924_44379 8612 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pTSara*, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8612) AUTHORS Boehm CR, Grant PK, Haseloff J. TITLE Programmed emergence of a domain of gene expression in a bacterial population JOURNAL Unpublished REFERENCE 2 (bases 1 to 8612) AUTHORS Boehm CR. TITLE Direct Submission JOURNAL Submitted (12-OCT-2016) Plant Sciences, University of Cambridge, Downing Street, Cambridge, Cambridgeshire CB2 3EA, United Kingdom REFERENCE 3 (bases 1 to 8612) TITLE Direct Submission REFERENCE 4 (bases 1 to 8612) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-OCT-2016) Plant Sciences, University of Cambridge, Downing Street, Cambridge, Cambridgeshire CB2 3EA, United Kingdom" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..8612 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(99..974) /label=araC /note="L-arabinose regulatory protein" regulatory complement(976..1025) /label=araC promoter /note="araC promoter" /regulatory_class="promoter" terminator complement(1218..1245) /label=T7Te terminator /note="phage T7 early transcription terminator" CDS complement(1298..1837) /codon_start=1 /product="T7RNAP" /label=T7RNAP /protein_id="ATP60602.1" /translation="MNTINIAKNDFSDIELAAIPFNTLADHYGERLAREQLALEHESYE MGEARFRKMFERQLKAGEVADNAAAKPLITTLLPKMIARINDWFEEVKAKRGKRPTAFQ FLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIGRAIEDEARFGRIRDLEAKHFK KNVEEQLNKRVGHVYK" regulatory complement(1838..1872) /label=N-terminal 500 RU, from Shis et al. 2013 /note="N-terminal 500 RU, from Shis et al. 2013" /regulatory_class="ribosome_binding_site" regulatory complement(1879..2009) /label=pBAD /note="pBAD" /regulatory_class="promoter" regulatory 2307..2437 /label=pBAD /note="pBAD" /regulatory_class="promoter" regulatory 2444..2474 /label=C-terminal 500 RU, from Shis et al. 2013 /note="C-terminal 500 RU, from Shis et al. 2013" /regulatory_class="ribosome_binding_site" CDS 2475..4592 /codon_start=1 /product="T7RNAP" /label=T7RNAP /protein_id="ATP60603.1" /translation="MKAFMQVVEADMLSKGLLGGEAWSSWHKEDSIHVGVRCIEMLIES TGMVSLHRQNAGVVGQDSETIELAPEYAEAIATRAGALAGISPMFQPCVVPPKPWTGIT GGGYWANGRRPLALVRTHSKKALMRYEDVYMPEVYKAINIAQNTAWKINKKVLAVANVI TKWKHCPVEDIPAIEREELPMKPEDIDMNPEALTAWKRAAAAVYRKDKARKSRRISLEF MLEQANKFANHKAIWFPYNMDWRGRVYAVSMFNPQGNDMTKGLLTLAKGKPIGKEGYYW LKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSPLENTWWAEQDSPFCFLAFCFEY AGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSETVQDIYGIVAKK VNEILQADAINGTDNEVVTVTDENTGEISEKVKLGTKALAGQWLAYGVTRSVTKSSVMT LAYGSKEFGFRQQVLEDTIQPAIDSGKGLMFTQPNQAAGYMAKLIWESVSVTVVAAVEA MNWLKSAAKLLAAEVKDKKTGEILRKRCAVHWVTPDGFPVWQEYKKPIQTRLNLMFLGQ FRLQPTINTNKDSEIDAHKQESGIAPNFVHSQDGSHLRKTVVWAHEKYGIESFALIHDS FGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESQLDKMPALPAKGNLNL RDILESDFAFA" terminator 4825..4911 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 5003..5030 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 5049..5140 /label=AmpR promoter rep_origin 5594..6049 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS complement(6607..7263) /label=CmR /note="chloramphenicol acetyltransferase" promoter complement(7264..7366) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin complement(7892..8437) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin."
This page is informational only.