Basic Vector Information
- Vector Name:
- pTS1
- Antibiotic Resistance:
- Tetracycline
- Length:
- 8893 bp
- Type:
- Suicide vector
- Replication origin:
- ori
- Source/Author:
- Scott TA, Heine D, Qin Z, Wilkinson B.
- Promoter:
- sacB
pTS1 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pTS1 vector Sequence
LOCUS 40924_44314 8893 bp DNA circular SYN 18-DEC-2018
DEFINITION Suicide vector pTS1, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 8893)
AUTHORS Scott TA, Heine D, Qin Z, Wilkinson B.
TITLE An L-threonine transaldolase is required for
L-threo-beta-hydroxy-alpha-amino acid assembly during obafluorin
biosynthesis
JOURNAL Nat Commun 8, 15935 (2017)
PUBMED 28649989
REFERENCE 2 (bases 1 to 8893)
AUTHORS Scott TA.
TITLE Direct Submission
JOURNAL Submitted (30-SEP-2016) Molecular Microbiology, John Innes Centre,
Norwich Research Park, Norwich, Norfolk NR4 7UH, United Kingdom
REFERENCE 3 (bases 1 to 8893)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 8893)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun
8, 15935 (2017)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(30-SEP-2016) Molecular Microbiology, John Innes Centre, Norwich
Research Park, Norwich, Norfolk NR4 7UH, United Kingdom"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..8893
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS complement(724..1371)
/label=TetR
/note="tetracycline resistance regulatory protein"
CDS 1477..2673
/label=TcR
/note="tetracycline efflux protein"
CDS 2679..2825
/codon_start=1
/gene="exc2"
/product="Exc2"
/label=exc2
/protein_id="AQZ26572.1"
/translation="METIGNSLRGTTQFAGTDYRSKDLTPKKSRLLADTISAVYLDGYE
GRQ"
gene 2679..2825
/gene="exc2"
/label=exc2
misc_feature complement(2800..3083)
/label=cer region
/note="ColE1-derived recombination site that helps to
maintain plasmids as monomers"
CDS complement(3039..4589)
/gene="mbeA"
/label=mbeA
/note="DNA relaxase MbeA from Escherichia coli. Accession#:
P13658"
CDS complement(4582..4926)
/gene="mbeC"
/label=mbeC
/note="Mobilization protein MbeC from Escherichia coli.
Accession#: P13657"
CDS 4966..5154
/label=rop
/note="Rop protein, which maintains plasmids at low copy
number"
oriT 5242..5330
/note="oriT"
rep_origin complement(5574..6164)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS 6369..6710
/codon_start=1
/gene="colE1"
/product="colicin E1 immunity protein"
/label=colE1
/protein_id="AQZ26577.1"
/translation="MSLRYYIKNILFGLYCTLIYIYLITKNSEGYYFLVSDKMLYAIVI
STILCPYSKYAIEYIAFNFIKKDFFERRKNLNNAPVAKLNLFMLYNLLCLVLAIPFGLL
GLFISIKNN"
gene 6369..6710
/gene="colE1"
/label=colE1
CDS complement(6890..8308)
/label=SacB
/note="secreted levansucrase that renders bacterial growth
sensitive to sucrose"
promoter complement(8309..8754)
/label=sacB promoter
/note="sacB promoter and control region"
misc_feature 8777..8833
/label=MCS
/note="pUC18/19 multiple cloning site"
This page is informational only.