Basic Vector Information
pTR_KJUMPS vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pTR_KJUMPS vector Sequence
LOCUS 40924_44309 6334 bp DNA circular SYN 18-DEC-2018
DEFINITION Expression vector pTR_KJUMPS DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6334)
AUTHORS Kasai Y, Matsuzaki K, Ikeda F, Yoshimitsu Y, Harayama S.
TITLE Precise excision of a selectable marker gene in transgenic
Pseudococcomyxa strains by the piggyBac transposase
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 6334)
AUTHORS Kasai Y, Harayama S.
TITLE Direct Submission
JOURNAL Submitted (08-JUN-2017) Contact:Yuki Kasai Chuo University, Research
and Development Initiative; 1-13-27 Kasuga, Bunkyo-ku, Tokyo
112-8551, Japan
REFERENCE 3 (bases 1 to 6334)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6334)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(08-JUN-2017) Contact:Yuki Kasai Chuo University, Research and
Development Initiative; 1-13-27 Kasuga, Bunkyo-ku, Tokyo 112-8551,
Japan"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6334
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 1..858
/label=AmpR
/note="beta-lactamase"
rep_origin 1032..1620
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 1908..1929
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 1944..1974
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 1982..1998
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 2006..2022
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
mobile_element 2513..2547
/mobile_element_type="transposon"
/label=transposon
/note="piggyBac transposon 5' terminal repeat"
regulatory 2548..3195
/gene="EF1a"
/note="Includes promoter region of Pseudococcomyxa sp.
strain KJ nuclear gene EF1a for elongation factor 1 alpha
subunit"
/regulatory_class="promoter"
gene 2548..3195
/gene="EF1a"
/label=EF1a
regulatory 3190..3199
/note="vertebrate consensus sequence for strong initiation
of translation (Kozak, 1987)"
/regulatory_class="other"
CDS 3196..4701
/codon_start=1
/gene="UMPS"
/product="uridine monophosphate synthase"
/label=UMPS
/protein_id="BAY00745.1"
/translation="MATSTPSVATAAELKPKEGPITSQEFEELVLRLHEIEAVKFGNFK
LKSGLMSPIYIDLRVIVSYPDVLRRVAEVMWHQVSGAGFDVMCGVPYTALPIATCMSLL
HGTPMLMRRKEVKEYGTKKAIEGAFKKGQTCLIVEDLVTSGASVMETVEPLEVEGLKVA
DVVVLIDREQGGAARMASNGLRLHSAFTLSFIIKTLQAHGLVSAEVADSVAAFIAANQT
FSPSAAAAPTPASAPPAQPKRLPFGERAALCQNAAGRKLLELMARKRTNLAVAADVATV
EEMLRIADAAGPHIAVFKTHVDIFDEWDDGIAAQLRHLADKHEFLIFEDRKFADIGNTV
VSQYGGGIYKIADWSDITNAHLVPGPGIIDGLRKVGQEKGRGLLLLAEMSSKGALATGA
YTEKVAEAAAANQDFVMGFICQSPAKWATSVPPGLVHMTPGVQLASGSDALGQQYNTPA
SVIGQGGSDVIIVGRGIIKAADPAAAAAQYREAGWAAYEATLA"
gene 3196..4701
/gene="UMPS"
/label=UMPS
regulatory 4702..5398
/gene="EF1a"
/note="Includes terminator region of Pseudococcomyxa sp.
strain KJ nuclear gene EF1a for elongation factor alpha
subunit"
/regulatory_class="terminator"
gene 4702..5398
/gene="EF1a"
/label=EF1a
mobile_element 5399..5461
/mobile_element_type="transposon"
/label=transposon
/note="piggyBac transposon 3' inverted terminal repeat"
primer_bind complement(5591..5607)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
rep_origin 5749..6204
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 6230..6334
/label=AmpR promoter
This page is informational only.