pTrypRNAiGate vector (V002518)

Basic Vector Information

      • Vector Name:
      • pTrypRNAiGate
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 9177 bp
      • Type:
      • Cloning vector
      • Replication origin:
      • ori
      • Source/Author:
      • Kalidas S, Li Q, Phillips MA.
      • Promoter:
      • lac UV5

pTrypRNAiGate vector Vector Map

pTrypRNAiGate9177 bp40080012001600200024002800320036004000440048005200560060006400680072007600800084008800rRNA locus intergenic fragmentBleoRT7 promotertet operatortet operatorattR1lac UV5 promoterCmRccdBattR2attR2ccdBCmRlac UV5 promoterattR1SP6 promoterAmpR promoterAmpRori

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pTrypRNAiGate vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_44304        9177 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pTrypRNAiGate, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9177)
  AUTHORS   Kalidas S, Li Q, Phillips MA.
  TITLE     A Gateway((R)) compatible vector for gene silencing in bloodstream 
            form Trypanosoma brucei
  JOURNAL   Mol. Biochem. Parasitol. 178 (1-2), 51-55 (2011)
  PUBMED    21420443
REFERENCE   2  (bases 1 to 9177)
  AUTHORS   Kalidas S, Li Q, Phillips M.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2011) Department of Pharmacology, UT Southwestern 
            Medical Center, 6001 Forest Park Rd, Dallas, TX 75390-9041, USA
REFERENCE   3  (bases 1 to 9177)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9177)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Mol. 
            Biochem. Parasitol. 178 (1-2), 51-55 (2011)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (30-MAR-2011) Department of Pharmacology, UT Southwestern Medical 
            Center, 6001 Forest Park Rd, Dallas, TX 75390-9041, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9177
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    complement(100..732)
                     /label=rRNA locus intergenic fragment
                     /note="rRNA locus intergenic fragment"
     CDS             complement(1085..1456)
                     /codon_start=1
                     /label=BleoR
                     /note="antibiotic-binding protein"
                     /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD
                     VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR
                     EFALRDPAGNCVHFVAEEQD"
     promoter        complement(1600..1618)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     protein_bind    1883..1901
                     /label=tet operator
                     /note="bacterial operator O2 for the tetR and tetA genes"
     protein_bind    1904..1922
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     protein_bind    2053..2177
                     /label=attR1
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        2202..2232
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an 'up' mutation"
     CDS             2286..2942
                     /codon_start=1
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     CDS             3287..3589
                     /codon_start=1
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK
                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
     protein_bind    complement(3633..3757)
                     /label=attR2
                     /note="recombination site for the Gateway(R) LR reaction"
     protein_bind    4213..4337
                     /label=attR2
                     /note="recombination site for the Gateway(R) LR reaction"
     CDS             complement(4381..4683)
                     /codon_start=1
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK
                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
     CDS             complement(5028..5684)
                     /codon_start=1
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     promoter        complement(5738..5768)
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an 'up' mutation"
     protein_bind    complement(5793..5917)
                     /label=attR1
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        complement(6413..6431)
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"
     promoter        7217..7321
                     /label=AmpR promoter
     CDS             7322..8179
                     /codon_start=1
                     /label=AmpR
                     /note="beta-lactamase"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHSMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     rep_origin      8353..8941
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.