Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V002520 | pTRKH2 | In stock (lyophilized plasmid) |
Buy one, get one free! |
Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.
Basic Vector Information
pTRKH2 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pTRKH2 vector Sequence
LOCUS 40924_44277 6721 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pTRKH2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6721) AUTHORS Welker DL, Hughes JE, Steele JL, Broadbent JR. TITLE High efficiency electrotransformation of Lactobacillus casei JOURNAL FEMS Microbiol. Lett. 362 (2), 1-6 (2015) PUBMED 25670703 REFERENCE 2 (bases 1 to 6721) AUTHORS Welker DL, Hughes JE, Steele JL, Broadbent JR. TITLE Direct Submission JOURNAL Submitted (03-NOV-2017) Biology, Utah State University, 5305 Old Main Hill, Logan, UT 84322-5305, USA REFERENCE 3 (bases 1 to 6721) TITLE Direct Submission REFERENCE 4 (bases 1 to 6721) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "FEMS Microbiol. Lett."; date: "2015"; volume: "362"; issue: "2"; pages: "1-6" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (03-NOV-2017) Biology, Utah State University, 5305 Old Main Hill, Logan, UT 84322-5305, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..6721 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 102..123 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 138..168 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 176..192 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 200..216 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" primer_bind complement(295..311) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS 992..1726 /gene="ermBP" /label=ermBP /note="rRNA adenine N-6-methyltransferase from Enterococcus faecalis. Accession#: P0A4D5" regulatory 2384..5298 /label=Enterococcus origin region from pAMBeta1 /note="Enterococcus origin region from pAMBeta1" /regulatory_class="replication_regulatory_region" CDS 3312..4802 /codon_start=1 /gene="repR" /product="RepR" /label=repR /note="DNA replication protein" /protein_id="AXU41049.1" /translation="MNIPFVVETVLHDGLLKYKFKNSKIRSITTKPGKSKGAIFAYRSK SSMIGGRGVVLTSEEAIQENQDTFTHWTPNVYRYGTYADENRSYTKGHSENNLRQINTF FIDFDIHTAKETISASDILTTAIDLGFMPTMIIKSDKGYQAYFVLETPVYVTSKSEFKS VKAAKIISQNIREYFGKSLPVDLTCNHFGIARIPRTDNVEFFDPNYRYSFKEWQDWSFK QTDNKGFTRSSLTVLSGTEGKKQVDEPWFNLLLHETKFSGEKGLIGRNNVMFTLSLAYF SSGYSIETCEYNMFEFNNRLDQPLEEKEVIKIVRSAYSENYQGANREYITILCKAWVSS DLTSKDLFVRQGWFKFKKKRSERQRVHLSEWKEDLMAYISEKSDVYKPYLVTTKKEIRE VLGIPERTLDKLLKVLKANQEIFFKIKPGRNGGIQLASVKSLLLSIIKVKKEEKESYIK ALTNSFDLEHTFIQETLNKLAERPKTDTQLDLFSYDTG" gene 3312..4802 /gene="repR" /label=repR promoter complement(5512..5614) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin complement(6140..6685) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin."