pTpPuc3 vector (V002564)

Basic Vector Information

      • Vector Name:
      • pTpPuc3
      • Antibiotic Resistance:
      • Kanamycin
      • Length:
      • 7796 bp
      • Type:
      • Cloning vector
      • Replication origin:
      • ori
      • Source/Author:
      • Karas BJ, Diner RE, Lefebvre SC, Weyman PD.
      • Promoter:
      • HIS3

pTpPuc3 vector Vector Map

pTpPuc37796 bp3006009001200150018002100240027003000330036003900420045004800510054005700600063006600690072007500traJoriTM13 fwdNrsRCEN/ARSHIS3 promoterHIS3M13 revlac operatorlac promoterCAP binding siteoriKanRAmpR promoter

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pTpPuc3 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_43823        7796 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pTpPuc3, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7796)
  AUTHORS   Karas BJ, Diner RE, Lefebvre SC, Weyman PD.
  TITLE     Designer Diatom episomes Delivered by Bacterial Conjugation
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7796)
  AUTHORS   Karas BJ, Diner RE, Lefebvre SC, Weyman PD.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-FEB-2015) Synthetic Biology and Bioenergy Group, J. 
            Craig Venter Institute, 4120 Capricorn Lane, La Jolla, CA 92037, USA
REFERENCE   3  (bases 1 to 7796)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7796)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (03-FEB-2015) Synthetic Biology and Bioenergy Group, J. Craig Venter
            Institute, 4120 Capricorn Lane, La Jolla, CA 92037, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7796
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(310..678)
                     /codon_start=1
                     /label=traJ
                     /note="oriT-recognizing protein"
                     /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV
                     GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE
                     KQDELGKVMMGVVRPRAEP"
     oriT            complement(711..820)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"
     primer_bind     1098..1114
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             2096..2662
                     /codon_start=1
                     /label=NrsR
                     /note="nourseothricin acetyltransferase"
                     /translation="MTTLDDTAYRYRTSVPGDAEAIEALDGSFTTDTVFRVTATGDGFT
                     LREVPVDPPLTKVFPDDESDDESDAGEDGDPDSRTFVAYGDDGDLAGFVVVSYSGWNRR
                     LTVEDIEVAPEHRGHGVGRALMGLATEFARERGAGHLWLEVTNVNAPAIHAYRRMGFTL
                     CGLDTALYDGTASDGEQALYMSMPCP"
     misc_feature    3185..3688
                     /label=CEN/ARS
                     /note="S. cerevisiae CEN6 centromere fused to an
                     autonomously replicating sequence"
     promoter        3689..3876
                     /label=HIS3 promoter
     CDS             3877..4533
                     /codon_start=1
                     /label=HIS3
                     /note="imidazoleglycerol-phosphate dehydratase, required
                     for histidine biosynthesis"
                     /translation="MTEQKALVKRITNETKIQIAISLKGGPLAIEHSIFPEKEAEAVAE
                     QATQSQVINVHTGIGFLDHMIHALAKHSGWSLIVECIGDLHIDDHHTTEDCGIALGQAF
                     KEALLARGVKRFGSGFAPLDEALSRAVVDLSNRPYAVVELGLQREKVGDLSCEMIPHFL
                     ESFAEASRITLHVDCLRGKNDHHRSESAFKALAVAIREATSPNGTNDVPSTKGVLM"
     primer_bind     complement(4605..4621)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(4629..4645)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(4653..4683)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(4698..4719)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(5007..5595)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             6443..7255
                     /codon_start=1
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     promoter        complement(7597..7701)
                     /label=AmpR promoter

This page is informational only.