Basic Vector Information
- Vector Name:
- pToxin-mfLON
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4692 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Chan CT, Lee JW, Cameron DE, Bashor CJ, Collins JJ.
pToxin-mfLON vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pToxin-mfLON vector Sequence
LOCUS 40924_43813 4692 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pToxin-mfLON, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4692) AUTHORS Chan CT, Lee JW, Cameron DE, Bashor CJ, Collins JJ. TITLE 'Deadman' and 'Passcode' microbial kill switches for bacterial containment JOURNAL Nat. Chem. Biol. 12 (2), 82-86 (2016) PUBMED 26641934 REFERENCE 2 (bases 1 to 4692) AUTHORS Chan CTY., Lee JW, Cameron DE, Bashor CJ, Collins JJ. TITLE Direct Submission JOURNAL Submitted (12-OCT-2015) Department of Biological Engineering, Massachusetts Institute of Technology, 77 Massachusetts Ave., E25-302b, Cambridge, MA 02139, USA REFERENCE 3 (bases 1 to 4692) TITLE Direct Submission REFERENCE 4 (bases 1 to 4692) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Chem. Biol."; date: "2016"; volume: "12"; issue: "2"; pages: "82-86" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-OCT-2015) Department of Biological Engineering, Massachusetts Institute of Technology, 77 Massachusetts Ave., E25-302b, Cambridge, MA 02139, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..4692 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 7..80 /label=pLscrO-2 /note="pLscrO-2" /regulatory_class="promoter" regulatory 81..102 /label=RBS /note="RBS" /regulatory_class="ribosome_binding_site" CDS 103..2547 /codon_start=1 /product="mfLON protease" /label=mfLON protease /protein_id="ALP32109.1" /translation="MSKKIKLPIFQIRGSFIVPGIKENLEVGRKNTLASVNYAIKNSNN QMIAIPQIDASVEKPEFSDLHEFGILIDFEVIKEWKDNSLTISTNPIQRCKVISFFENE DQVPYAEVELIESINDFSDEELKELIEKISDAIKTKASLVTKQIKQLISGESDDLSLAF DSIMFKLAPSKILTNPEYITSPSLKTRWSIIEKIIFAEDGIITRNAESIDAARQKNEIE QELNHKLKEKMDKQQKEYYLREKMRIIKDELEDEDDSDDSSLEKYKERLAKEPFPEEVK RKIMASIKRVEALQSGTPEWNTEKNYIDWMMSIPWWEETEDLTDLKYAKKILDKHHYGM KKVKERIIEYLAVKTKTKSLKAPIITLVGPPGVGKTSLAKSIAEAVGKNFVKVSLGGVK DESEIRGHRKTYVGSMPGRIIQTMKRAKVKNPLFLLDEIDKMASDHRGDPASAMLEVLD PEQNKEFSDHYIEEPYDLSQVMFIATANYPEDIPEALYDRMEIINLSSYTEIEKVKIAQ DYLVPKAIEQHELTSEEISFTEGAINEIIKYYTREAGVRQLERHINSIIRKYIVKNLNG EMDKIVIDEKQVNDLLGKRIFDHTEKQEESQIGVVTGLAYTQFGGDILPIEVSLYPGKG NLILTGKLGEVMKESATIALTYVKSNFEKFGVDKKVFEENDIHVHVPEGAVPKDGPSAG ITITTALISALSDKPVSKEIGMTGEITLRGNVLPIGGLREKSISASRSGLKTIIIPKKN ERDLDEIPDEVKAKLKIIPAEKYEEVFAIVFKTKAANKNEENTNEVPTFMLNAGQANRR RV" terminator 2589..2675 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" rep_origin 2796..3341 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." terminator complement(3503..3597) /label=lambda t0 terminator /note="transcription terminator from phage lambda" CDS complement(3630..4487) /label=AmpR /note="beta-lactamase" promoter complement(4488..4592) /label=AmpR promoter
This page is informational only.