pTNS2 vector (Cat. No.: V002576)
Note: pTNS2 is a helper plasmid for Tn7 transposition (Tn7 transposase expression), carrying the tnsABCD genes encoding transposase enzymes. It has an R6K origin, requires Pir1 strains for replication, confers ampicillin resistance, and is used to integrate DNA into bacterial chromosomes at specific attTn7sites
- Name:
- pTNS2
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9615 bp
- Type:
- T7 transposase expression vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Choi KH, Gaynor JB, White KG, Lopez C, Bosio CM, Karkhoff-Schweizer RR, Schweizer HP.
- Growth Strain(s):
- DH5α- λpir
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Choi KH, Gaynor JB, White KG, Lopez C, Bosio CM, Karkhoff-Schweizer RR, Schweizer HP. A Tn7-based broad-range bacterial cloning and expression system. Nat Methods. 2005 Jun;2(6):443-8.
pTNS2 vector (Cat. No.: V002576) Sequence
LOCUS pTNS2 9615 bp DNA circular SYN 26-DEC-2025
DEFINITION Exported.
ACCESSION V002576
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 9615)
AUTHORS Choi KH, Gaynor JB, White KG, Lopez C, Bosio CM, Karkhoff-Schweizer
RR, Schweizer HP.
TITLE A Tn7-based broad-range bacterial cloning and expression system
JOURNAL Nat. Methods 2 (6), 443-448 (2005)
PUBMED 15908923
REFERENCE 2 (bases 1 to 9615)
AUTHORS Choi K-H., Gaynor JB, White KG, Lopez CM, Karkhoff-Schweizer RK,
Schweizer HP.
TITLE Direct Submission
JOURNAL Submitted (12-JAN-2005) Microbiology, Immunology and Pathology,
Colorado State University, Fort Collins, CO 80523, USA
REFERENCE 3 (bases 1 to 9615)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 9615)
TITLE Direct Submission
REFERENCE 5 (bases 1 to 9615)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat.
Methods"; date: "2005"; volume: "2"; issue: "6"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(12-JAN-2005) Microbiology, Immunology and Pathology, Colorado State
University, Fort Collins, CO 80523, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT SGRef: number: 4; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..9615
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 379..395
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
CDS complement(688..2214)
/codon_start=1
/gene="tnsD"
/product="Tn7 transposase subunit"
/label=tnsD
/note="TnsD"
/protein_id="AAW78923.1"
/translation="MRNFPVPYSNELIYSTIARAGVYQGIVSPKQLLDEVYGNRKVVAT
LGLPSHLGVIARHLHQTGRYAVQQLIYEHTLFPLYAPFVGKERRDEAIRLMEYQAQGAV
HLMLGVAASRVKSDNRFRYCPDCVALQLNRYGEAFWQRDWYLPALPYCPKHGALVFFDR
AVDDHRHQFWALGHTELLSDYPKDSLSQLTALAAYIAPLLDAPRAQELSPSLEQWTLFY
QRLAQDLGLTKSKHIRHDLVAERVRQTFSDEALEKLDLKLAENKDTCWLKSIFRKHRKA
FSYLQHSIVWQALLPKLTVIEALQQASALTEHSITTRPVSQSVQPNSEDLSVKHKDWQQ
LVHKYQGIKAARQSLEGGVLYAWLYRHDRDWLVHWNQQHQQERLAPAPRVDWNQRDRIA
VRQLLRIIKRLDSSLDHPRATSSWLLKQTPNGTSLAKNLQKLPLVALCLKRYSESVEDY
QIRRISQAFIKLKQEDVELRRWRLLRSATLSKERITEEAQRFLEMVYGEE"
gene complement(688..2214)
/gene="tnsD"
/label=tnsD
CDS complement(2220..3884)
/gene="tnsC"
/label=Transposon Tn7 transposition protein TnsC
/note="Transposon Tn7 transposition protein TnsC from
Escherichia coli. Accession#: P05846"
CDS complement(3884..5989)
/gene="tnsB"
/label=Transposon Tn7 transposition protein TnsB
/note="Transposon Tn7 transposition protein TnsB from
Escherichia coli. Accession#: P13989"
mobile_element 6707..6931
/label=Tn7R
/note="mini-Tn7 element (right end of the Tn7 transposon)"
primer_bind complement(7143..7158)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(7166..7182)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(7190..7220)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(7235..7256)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
oriT 7631..7739
/label=oriT
/note="incP origin of transfer"
rep_origin 7762..8146
/label=R6K gamma ori
/note="gamma replication origin from E. coli plasmid R6K;
requires the R6K initiator protein pi for replication"
CDS complement(8558..9415)
/label=AmpR
/note="beta-lactamase"
promoter complement(9416..9520)
/label=AmpR promoter