Basic Vector Information
- Vector Name:
- pTXB1-Tn5
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7716 bp
- Type:
- Bacterial Expression
- Replication origin:
- ori
- Copy Number:
- High Copy
- Promoter:
- T7 promoter
- Cloning Method:
- Restriction Enzyme
- 5' Primer:
- T7 promoter primer
- 3' Primer:
- GATTGCCATGCCGGTCAAGG
pTXB1-Tn5 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pTXB1-Tn5 vector Sequence
LOCUS 40924_44549 7716 bp DNA circular SYN 13-MAY-2021 DEFINITION IPTG-inducible expression of Transposon Tn5 fused to Mxe Intein and Chitin-binding domain.. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7716) AUTHORS Picelli S, Bjorklund AK, Reinius B, Sagasser S, Winberg G, Sandberg R TITLE Tn5 transposase and tagmentation procedures for massively-scaled sequencing projects. JOURNAL Genome Res. 2014 Jul 30. pii: gr.177881.114. PUBMED 25079858 REFERENCE 2 (bases 1 to 7716) TITLE Direct Submission REFERENCE 3 (bases 1 to 7716) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Genome Res. 2014 Jul 30. pii: gr.177881.114." COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..7716 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 126..148 /label=pGEX 3' /note="pGEX vectors, reverse primer" CDS complement(145..333) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" protein_bind complement(856..877) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(893..1972) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(1973..2050) /label=lacI promoter terminator 2203..2289 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 2386..2472 /gene="Escherichia coli rrnB" /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator complement(2572..2615) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" promoter 2790..2808 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 2809..2833 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 2877..4304 /codon_start=1 /label=Tn5 transposase /note="transposase from the bacterial Tn5 transposon (Reznikoff, 1993)" /translation="MITSALHRAADWAKSVFSSAALGDPRRTARLVNVAAQLAKYSGKS ITISSEGSKAMQEGAYRFIRNPNVSAEAIRKAGAMQTVKLAQEFPELLAIEDTTSLSYR HQVAEELGKLGSIQDKSRGWWVHSVLLLEATTFRTVGLLHQEWWMRPDDPADADEKESG KWLAAAATSRLRMGSMMSNVIAVCDREADIHAYLQDKLAHNERFVVRSKHPRKDVESGL YLYDHLKNQPELGGYQISIPQKGVVDKRGKRKNRPARKASLSLRSGRITLKQGNITLNA VLAEEINPPKGETPLKWLLLTSEPVESLAQALRVIDIYTHRWRIEEFHKAWKTGAGAER QRMEEPDNLERMVSILSFVAVRLLQLRESFTPPQALRAQGLLKEAEHVESQSAETVLTP DECQLLGYLDKGKRKRKEKAGSLQWAYMAIARLGGFMDSKRTGIASWGALWEGWEALQS KLDGFLAAKDLMAQGIKI" CDS 4305..4898 /codon_start=1 /label=Mxe GyrA intein /note="modified GyrA intein (Southworth et al., 1999)" /translation="CITGDALVALPEGESVRIADIVPGARPNSDNAIDLKVLDRHGNPV LADRLFHSGEHPVYTVRTVEGLRVTGTANHPLLCLVDVAGVPTLLWKLIDEIKPGDYAV IQRSAFSVDCAGFARGKPEFAPTTYTVGVPGLVRFLEAHHRDPDAQAIADELTDGRFYY AKVASVTDAGVQPVYSLRVDTADHAFITNGFVSHA" CDS 4929..5084 /codon_start=1 /label=CBD /note="chitin binding domain from chitinase A1 (Watanabe et al., 1994)" /translation="TTNPGVSAWQVNTAYTAGQLVTYNGKTYKCLQPHTSLAGWEPSNV PALWQLQ" terminator 5163..5210 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" promoter 5270..5374 /label=AmpR promoter CDS 5375..6232 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" rep_origin complement(6277..6790) /direction=LEFT /label=M13 ori /note="M13 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" rep_origin 6901..7489 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" primer_bind 7643..7660 /label=L4440 /note="L4440 vector, forward primer" primer_bind complement(7682..7701) /label=pRS-marker /note="pRS vectors, use to sequence yeast selectable marker"
This page is informational only.