Human L-Lambda WT vector (Cat. No.: V018138)
Note: High-level human immunoglobulin expression in mammalian cells, especially HEK293 derivatives (like 293-6E), by leveraging the Epstein-Barr virus (EBV) origin of replication (OriP) and a strong CMV promoter.
- Name:
- Human L-Lambda WT
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4773 bp
- Type:
- Mammalian Expression Vectors
- Copy Number:
- High copy number
- Promoter:
- CMV
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
- Expression Method:
- Transient
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
Human L-Lambda WT vector (Cat. No.: V018138) Sequence
LOCUS Exported 4773 bp DNA circular SYN 08-DEC-2025
DEFINITION synthetic circular DNA
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4773)
AUTHORS 11111111
TITLE Direct Submission
FEATURES Location/Qualifiers
source 1..4773
/mol_type="other DNA"
/organism="synthetic DNA construct"
enhancer 42..421
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 422..625
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
promoter 688..1172
/label=Adenovirus TPL and MLP
/label=Adenovirus Tripartite Leader and Major Late
Promoter
/note="Regulatory DNA sequence from adenovirus containing
both the tripartite leader and major late promoter
elements, functioning to initiate and enhance transcription
of late viral genes.; id: 3685243"
sig_peptide 1236..1289
/product="human interleukin 10 signal peptide"
CDS 1302..1622
/codon_start=1
/product="constant region of human immunoglobulin labmda
chain"
/label=human Lambda
/translation="GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKAD
GSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
CS"
polyA_site 1649..1704
/label=beta-globin poly(A) signal
/note="rabbit beta-globin polyadenylation signal"
misc_feature 2017..2744
/label=OriP
/note="Epstein-Barr virus (EBV) origin of replication"
promoter 2873..2977
/gene="bla"
/label=AmpR promoter
CDS 2978..3838
/codon_start=1
/gene="bla"
/product="beta-lactamase"
/label=AmpR
/note="confers resistance to ampicillin, carbenicillin, and
related antibiotics"
/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
LIKHW"
rep_origin 4009..4597
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"