pWB980-ori (pUC980-2) vector (Cat. No.: V017497)
Note: pWB980 derived from pUB110 is an expression vector in Bacillus for its high copy number and high stability. It has a size of 4k base pairs, which is considered manageable and does not impose significant metabolic burden on the host cells. One key feature of the pWB980 plasmid is its bacterial resistance attribute, specifically for kanamycin. This feature is extremely useful as it allows for the selection and identification of bacterial cells that have successfully taken up the plasmid. pWB980 harbors the P43 promoter whose transcription direction is consistent with majority of the pUB110-encoded genes. This high-level promoter is popular for driving gene expression in Bacillus subtilis. It is important to note that the pWB980 vector is not a shuttle vector. Users are recommended to treat bacterial cells carrying this plasmid with lysozyme to maximize the plasmid yield during extraction.
pWB980-ori (pUC980-2) is a shuttle plasmid with an additional replication origin compared to pWB980.
- Name:
- pWB980-ori (pUC980-2)
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4276 bp
- Type:
- Bacillus Expression vector
- Copy Number:
- High copy number
- Promoter:
- P43
- Growth Strain(s):
- DH10B
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Zhao X, Xu J, Tan M, Zhen J, Shu W, Yang S, Ma Y, Zheng H, Song H. High copy number and highly stable Escherichia coli-Bacillus subtilis shuttle plasmids based on pWB980. Microb Cell Fact. 2020 Feb 7;19(1):25. doi: 10.1186/s12934-020-1296-5. PMID: 32028973; PMCID: PMC7006159.
pWB980-ori (pUC980-2) vector (Cat. No.: V017497) Sequence
LOCUS Exported 4276 bp DNA circular SYN 22-JAN-2026
DEFINITION synthetic circular DNA.
ACCESSION .
VERSION .
KEYWORDS pWB980-ori
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4276)
AUTHORS A
TITLE Direct Submission
REFERENCE 2 (bases 1 to 4276)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4276
/mol_type="other DNA"
/organism="synthetic DNA construct"
source join(3897..4276,1..3896)
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 149..170
/label=pwb980-p43-F
rep_origin 936..1524
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(1654..2424)
/codon_start=1
/product="aminoglycoside O-nucleotidyltransferase
ANT(4')-Ia [Staphylococcus aureus]"
/label=Kan
/translation="MRIVNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGR
QTDGPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFDSEEILLDYASQVESDWPLTHG
QFFSILPIYDSGGYLEKVYQTAKSVEAQTFHDAICALIVEELFEYAGKWRNIRVQGPTT
FLPSLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSD
SEKLLESLENFWNGIQEWTERHGYIVDVSKRIPF"
CDS complement(2584..3588)
/codon_start=1
/gene="repB"
/product="RepB replication protein"
/label=repB
/note="from Enterococcus faecalis plasmid pAM-alpha-1"
/db_xref="GI:22652809"
/protein_id="AAN03827.1"
/translation="MGVSFNIMCPNSSIYSDEKSRVLVDKTKSGKVRPWREKKIANVDY
FELLHILEFKKAERVKDCAEILEYKQNRETGERKLYRVWFCKSRLCPMCNWRRAMKHGI
QSQKVVAEVIKQKPTVRWLFLTLTVKNVYDGEELNKSLSDMAQGFRRMMQYKKINKNLV
GFMRATEVTINNKDNSYNQHMHVLVCVEPTYFKNTENYVNQKQWIQFWKKAMKLDYDPN
VKVQMIRPKNKYKSDIQSAIDETAKYPVKDTDFMTDDEEKNLKRLSDLEEGLHRKRLIS
YGGLLKEIHKKLNLDDTEEGDLIHTDDDEKADEDGFSIIAMWNWERKNYFIKE"
CDS complement(3982..4068)
/codon_start=1
/label=sacB signal peptide
/translation="MNIKKFAKQATVLTFTTALLAGGATQAFA"
promoter join(4110..4276,1..125)
/label=P43