Basic Vector Information
- Vector Name:
- pMP2463
- Antibiotic Resistance:
- Gentamycin
- Length:
- 5510 bp
- Replication origin:
- pBBR1 oriV
- Host:
- Broad host
- Promoter:
- Pc
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
pMP2463 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMP2463 vector Sequence
LOCUS 62056_17230 5510 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5510) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..5510 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 24..40 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 61..79 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind 109..125 /label=KS primer /note="common sequencing primer, one of multiple similar variants" CDS 177..893 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" promoter complement(947..965) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(975..991) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(1703..2362) /codon_start=1 /label=pBBR1 Rep /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR" rep_origin complement(2363..3134) /direction=LEFT /label=pBBR1 oriV /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication" CDS complement(4419..4949) /codon_start=1 /label=GmR /note="gentamycin acetyltransferase" /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQPRS EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR EEVMHFDIDPSTAT" promoter complement(5138..5166) /label=Pc promoter /note="class 1 integron promoter" protein_bind 5436..5457 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 5472..5502 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 5510 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)."
This page is informational only.