Basic Vector Information
- Vector Name:
- pNO183
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 5684 bp
- Type:
- Protein expression
- Replication origin:
- ori
- Host:
- E. coli
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
pNO183 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNO183 vector Sequence
LOCUS 62056_18180 5684 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5684) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..5684 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(181..275) /label=lambda t0 terminator /note="transcription terminator from phage lambda" CDS complement(299..955) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" CDS 2669..3610 /codon_start=1 /label=RpBphP1 /note="RpBphP1 is a bacterial phytochrome photoreceptor derived from Rhodopseudomonas palustris and used as a template in the engineering of the miRFP family of near-infrared fluorescent proteins." /translation="MAGHASGSPAFGTADLSNCEREEIHLAGSIQPHGALLVVSEPDHR IIQASANAAEFLNLGSVLGVPLAEIDGDLLIKILPHLDPTAEGMPVAVRCRIGNPSTEY DGLMHRPPEGGLIIELERAGPPIDLSGTLAPALERIRTAGSLRALCDDTALLFQQCTGY DRVMVYRFDEQGHGEVFSERHVPGLESYFGNRYPSSDIPQMARRLYERQRVRVLVDVSY QPVPLEPRLSPLTGRDLDMSGCFLRSMSPIHLQYLKNMGVRATLVVSLVVGGKLWGLVA CHHYLPRFIHFELRAICELLAEAIATRITALES" terminator 4873..4944 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 4960..4987 /label=T7Te terminator /note="phage T7 early transcription terminator" rep_origin complement(join(5189..5684,1..93)) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.