Price Information
| Cat No. | Plasmid Name | Availability | Buy one, get one free! (?) |
|---|---|---|---|
| V017175 | pT4-CMV-GFP | In stock, instant shipping |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
pT4-CMV-GFP is an optimized Sleeping Beauty transposon vector that uses a CMV promoter to drive efficient GFP expression, with its 12DR sequence specifically modified at the PAI subdomain-binding motif for enhanced transposition.
- Vector Name:
- pT4-CMV-GFP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5036 bp
- Type:
- Protein expression, Transposition
- Replication origin:
- ori
- Host:
- Mammalian cells
- Promoter:
- CMV
- Growth Strain(s):
- DH10B
- Growth Temperature:
- 37℃
pT4-CMV-GFP vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pT4-CMV-GFP vector Sequence
LOCUS Exported 5036 bp DNA circular SYN 15-OCT-2025
DEFINITION synthetic circular DNA.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5036)
TITLE Direct Submission
REFERENCE 2 (bases 1 to 5036)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5036
/mol_type="other DNA"
/organism="synthetic DNA construct"
enhancer 2..380
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 381..582
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
intron 676..808
/label=chimeric intron
/note="chimera between introns from human beta-globin and
immunoglobulin heavy chain genes"
CDS 819..1535
/codon_start=1
/label=EGFP
/note="enhanced GFP"
/translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
EFVTAAGITLGMDELYK"
polyA_signal 1545..1593
/label=poly(A) signal
/note="synthetic polyadenylation signal"
misc_feature 1665..1894
/label=IR/DR(R)
misc_feature 1665..1696
/label=inner DR
/note="also designated 12DR"
misc_feature 1863..1894
/label=outer DR
/note="also designated 14DR"
promoter complement(1929..1947)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(1968..1984)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(1992..2008)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(2016..2046)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(2061..2082)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(2370..2958)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(3132..3989)
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="[TEM beta-lactamase fragment, 45 aa]
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
PVTEKHLTDGMTVRELCSAAITMSDNTAAKLLLTTIGGPKELTAFLHNMGDHVTRLDRW
EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
[TEM beta-lactamase fragment, 59 aa]
LIKHW"
promoter complement(3990..4094)
/label=AmpR promoter
rep_origin 4121..4576
/direction=RIGHT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 4717..4733
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 4743..4761
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
misc_feature complement(4789..5017)
/label=IR/DR(L)
misc_feature 4789..4820
/label=outer DR
/note="also designated 14DR"
misc_feature 4986..5017
/label=inner DR
/note="also designated 12DR"