Basic Vector Information
- Vector Name:
- 3xmScarletI_UtrCH
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6914 bp
- Type:
- Protein expression
- Replication origin:
- ori
- Host:
- Mammalian cells
- Selection Marker:
- Neo/G418
- Promoter:
- SV40
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
3xmScarletI_UtrCH vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
3xmScarletI_UtrCH vector Sequence
LOCUS 62056_136 6914 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6914) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..6914 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 1..304 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 305..508 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 553..1248 /codon_start=1 /label=mScarlet-I /note="bright monomeric red fluorescent protein evolved from a synthetic template (Bindels et al., 2016)" /translation="MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTA KLKVTKGGPLPFSWDILSPQFMYGSRAFIKHPADIPDYYKQSFPEGFKWERVMNFEDGG AVTVTQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDGVLKGDIK MALRLKDGGRYLADFKTTYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRH STGGMDELYQ" misc_feature 3466..3518 /label=MCS /note="multiple cloning site" polyA_signal 3642..3763 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(3770..4225) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 4252..4356 /label=AmpR promoter promoter 4358..4715 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 4750..5541 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 5776..5823 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 6152..6740 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 6855..6914 /label=CMV /note="Human cytomegalovirus immediate early enhancer/promoter"
This page is informational only.