Basic Vector Information
- Vector Name:
- pNI9
- Antibiotic Resistance:
- Tetracycline
- Length:
- 3113 bp
- Type:
- Gene knockout
- Replication origin:
- ori
- Host:
- E. coli
- Promoter:
- tet
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
pNI9 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNI9 vector Sequence
LOCUS 62056_18015 3113 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3113) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..3113 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 196..224 /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" CDS 272..1459 /codon_start=1 /label=TcR /note="tetracycline efflux protein" /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL AALTSLTSIIGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST" promoter complement(1637..1655) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(1660..1676) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" rep_origin 1962..2550 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(2880..2907) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(2999..3085) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.