Basic Vector Information
- Vector Name:
- pMO719
- Antibiotic Resistance:
- Streptomycin
- Length:
- 5111 bp
- Type:
- Gene template
- Replication origin:
- ori
- Host:
- Desulfovibrio
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
pMO719 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMO719 vector Sequence
LOCUS 62056_17190 5111 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5111) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..5111 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(268..295) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(387..473) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 537..553 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 569..668 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" protein_bind complement(2990..3089) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" promoter complement(3107..3125) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(3130..3146) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 3577..4365 /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin 4461..5049 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.