Basic Vector Information
- Vector Name:
- NRCoC
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8741 bp
- Type:
- Protein expression
- Replication origin:
- ori
- Host:
- Mammalian cells
- Selection Marker:
- Neo/G418
- Promoter:
- CMV
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
NRCoC vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
NRCoC vector Sequence
LOCUS 62056_1780 8741 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8741) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..8741 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 1..714 /codon_start=1 /label=GFP (S65T) /note="S65T variant of Aequorea victoria green fluorescent protein (Heim et al., 1995)" /translation="MGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTFTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE FVTAAGITHGMDELYK" primer_bind complement(4735..4751) /label=SK primer /note="common sequencing primer, one of multiple similar variants" polyA_signal 4917..5038 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(5045..5500) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 5527..5631 /label=AmpR promoter promoter 5633..5990 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 6025..6816 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 7051..7098 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 7427..8015 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" enhancer 8190..8493 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 8494..8697 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter"
This page is informational only.