Basic Vector Information
- Vector Name:
- pMK228
- Antibiotic Resistance:
- Streptomycin
- Length:
- 4588 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Hartsough LA, Kotlajich MV, Han B, Lin C-C.J.
pMK228 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMK228 vector Sequence
LOCUS 62056_17020 4588 bp DNA circular SYN 27-JUL-2020 DEFINITION Cloning vector pMK228, complete sequence. ACCESSION MN617162 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4588) AUTHORS Hartsough LA, Kotlajich MV, Han B, Lin C-C.J., Gambill L, Wang MC, Tabor JJ. TITLE Optogenetic control of gut bacterial metabolism JOURNAL Unpublished REFERENCE 2 (bases 1 to 4588) AUTHORS Hartsough LA, Kotlajich MV, Han B, Lin C-C.J., Gambill L, Wang MC, Tabor JJ. TITLE Direct Submission JOURNAL Submitted (26-OCT-2019) Bioengineering, Rice University, 6500 Main St., Houston, TX 77030, USA REFERENCE 3 (bases 1 to 4588) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-OCT-2019) Bioengineering, Rice University, 6500 Main St., Houston, TX 77030, USA" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..4588 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 24..171 /note="specR promoter; from KD13" /regulatory_class="promoter" CDS 172..960 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" terminator 975..1069 /label=lambda t0 terminator /note="transcription terminator from phage lambda" rep_origin 1183..1728 /direction=RIGHT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." misc_feature 1984..2018 /label=constitutive promoter J23106 /note="constitutive promoter J23106" misc_feature 2019..2053 /label=B0034 /note="B0034" CDS 2054..4315 /codon_start=1 /transl_table=11 /product="CcaS" /label=CcaS /protein_id="QLL27773.1" /translation="MGKFLIPIEFVFLAIAMTCYLWHRQNQERRRIEISIKQQTQRERF INQITQHIRQSLNLETVLNTTVAEVKTLLQVDRVLIYRIWQDGTGSAITESVNANYPSI LGRTFSDEVFPVEYHQAYTKGKVRAINDIDQDDIEICLADFVKQFGVKSKLVVPILQHN RASSLDNESEFPYLWGLLITHQCAFTRPWQPWEVELMKQLANQVAIAIQQSELYEQLQQ LNKDLENRVEKRTQQLAATNQSLRMEISERQKTEAALRHTNHTLQSLIAASPRGIFTLN LADQIQIWNPTAERIFGWTETEIIAHPELLTSNILLEDYQQFKQKVLSGMVSPSLELKC QKKDGSWIEIVLSAAPLLDSEENIAGLVAVVADITEQKRQAEQIRLLQSVVVNTNDAVV ITEAEPIDDPGPRILYVNEAFTKITGYTAEEMLGKTPRVLQGPKTSRTELDRVRQAISQ WQSVTVEVINYRKDGSEFWVEFSLVPVANKTGFYTHWIAVQRDVTERRRTEEVRLALER EKELSRLKTRFFSMASHEFRTPLSTALAAAQLLENSEVAWLDPDKRSRNLHRIQNSVKN MVQLLDDILIINRAEAGKLEFNPNWLDLKLLFQQFIEEIQLSVSDQYYFDFICSAQDTK ALVDERLVRSILSNLLSNAIKYSPGGGQIKIALSLDSEQIIFEVTDQGIGISPEDQKQI FEPFHRGKNVRNITGTGLGLMVAKKCVDLHSGSILLKSAVDQGTTVTICLKRYNHLPRA " terminator 4336..4407 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 4423..4450 /label=T7Te terminator /note="phage T7 early transcription terminator"
This page is informational only.