Basic Vector Information
- Vector Name:
- MCPyV
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8704 bp
- Type:
- Lentiviral expression vector
- Replication origin:
- ori
- Source/Author:
- Kervarrec T, Cheret J, Paus R, Houben R
- Promoter:
- EF-1α core
MCPyV vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
MCPyV vector Sequence
LOCUS V016552 8704 bp DNA circular SYN 06-SEP-2021
DEFINITION Exported.
ACCESSION V016552
VERSION V016552
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 8704)
AUTHORS Kervarrec T, Cheret J, Paus R, Houben R, Schrama D.
TITLE Transduction-induced overexpression of Merkel cell T antigens in
human hair follicles induces formation of pathological cell clusters
with Merkel cell carcinoma-like phenotype
JOURNAL Exp Dermatol (2021) In press
PUBMED 34386998
REFERENCE 2 (bases 1 to 8704)
AUTHORS Schrama D, Houben R, Kervarrec T.
TITLE Direct Submission
JOURNAL Submitted (27-JUL-2021) Dermatology, University Hospital Wuerzburg,
Josef-Schneider-Str. 2, Wuerzburg, Bavaria 97080, Deutschland
REFERENCE 3 (bases 1 to 8704)
AUTHORS .
TITLE Direct Submission
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
SGRef: number: 1; type: "Journal Article"; journalName: "Exp
Dermatol (2021) In press"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(27-JUL-2021) Dermatology, University Hospital Wuerzburg,
Josef-Schneider-Str. 2, Wuerzburg, Bavaria 97080, Deutschland"
FEATURES Location/Qualifiers
source 1..8704
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 6..233
/label="RSV promoter"
/note="Rous sarcoma virus enhancer/promoter"
LTR 234..414
/label="5' LTR (truncated)"
/note="truncated 5' long terminal repeat (LTR) from HIV-1"
misc_feature 458..583
/label="HIV-1 Psi"
/note="packaging signal of human immunodeficiency virus
type 1"
misc_feature 1076..1309
/label="RRE"
/note="The Rev response element (RRE) of HIV-1 allows for
Rev-dependent mRNA export from the nucleus to the
cytoplasm."
CDS 1493..1537
/label="gp41 peptide"
/note="antigenic peptide corresponding to amino acids 655
to 669 of the HIV envelope protein gp41 (Lutje Hulsik et
al., 2013)"
CDS 1686..1727
/note="Protein Tat from Human immunodeficiency virus type 1
group M subtype B (isolate WMJ22). Accession#: P12509"
/label="Protein Tat"
misc_feature 1804..1920
/label="cPPT/CTS"
/note="central polypurine tract and central termination
sequence of HIV-1"
promoter 2010..2213
/label="CMV promoter"
/note="human cytomegalovirus (CMV) immediate early
promoter"
CDS join(2299..2532,2964..3632)
/codon_start=1
/transl_table=11
/product="truncated MCPyV LT"
/label="truncated MCPyV LT"
/note="MCPyV LT 300"
/protein_id="QZR95626.1"
/translation="MDLVLNRKEREALCKLLEIAPNCYGNIPLMKAAFKRSCLKHHPDK
GGNPVIMMELNTLWSKFQQNIHKLRSDFSMFDEVDEAPIYGTTKFKEWWRSGGFSFGKA
YEYGPNPHGTNSRSRKPSSNASRGAPSGSSPPHSQSSSSGYGSFSASQASDSQSRGPDI
PPEHHEEPTSSSGSSSREETTNSGRESSTPNGTSVPRNSSRTDGTWEDLFCDESLSSPE
PPSSSEEPEEPPSSRSSPRQPPSSSAEEASSSQFTDEEYRSSSFTTPKTPPPFSRKRKF
GGSRSSASSASSASSTSTP"
CDS 2299..2859
/codon_start=1
/transl_table=11
/product="small T antigen"
/label="small T antigen"
/note="MCPyV small T antigen; sT"
/protein_id="QZR95627.1"
/translation="MDLVLNRKEREALCKLLEIAPNCYGNIPLMKAAFKRSCLKHHPDK
GGNPVIMMELNTLWSKFQQNIHKLRSDFSMFDEVSTKFPWEEYGTLKDYMQSGYNARFC
RGPGCMLKQLRDSKCACISCKLSRQHCSLKTLKQKNCLTWGECFCYQCFILWFGFPPTW
ESFDWWQKTLEETDYCLLHLHLF"
promoter 3674..3885
/label="EF-1-alpha core promoter"
/note="core promoter for human elongation factor
EF-1-alpha"
LTR 3898..4166
/label="5' LTR (truncated)"
/note="truncated 5' long terminal repeat (LTR) from human
T-cell leukemia virus (HTLV) type 1"
CDS 4193..4789
/label="PuroR"
/note="puromycin N-acetyltransferase"
misc_feature 4799..5387
/label="WPRE"
/note="woodchuck hepatitis virus posttranscriptional
regulatory element"
LTR 5461..5694
/label="3' LTR (Delta-U3)"
/note="self-inactivating 3' long terminal repeat (LTR) from
HIV-1"
polyA_signal 5766..5900
/label="SV40 poly(A) signal"
/note="SV40 polyadenylation signal"
rep_origin 5906..6041
/label="SV40 ori"
/note="SV40 origin of replication"
primer_bind complement(6079..6095)
/label="M13 rev"
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(6103..6119)
/label="lac operator"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(6127..6157)
/label="lac promoter"
/note="promoter for the E. coli lac operon"
protein_bind complement(6172..6193)
/label="CAP binding site"
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(6481..7069)
/direction=LEFT
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(7243..8100)
/label="AmpR"
/note="beta-lactamase"
promoter complement(8101..8205)
/label="AmpR promoter"
primer_bind 8679..8695
/label="M13 fwd"
/note="common sequencing primer, one of multiple similar
variants"
This page is informational only.