pTS9 vector (Cat. No.: V016393)
Basic Information
- Name:
- pTS9
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5191 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Schnabel T.
pTS9 vector (Cat. No.: V016393) Sequence
LOCUS 62056_21595 5191 bp DNA circular SYN 09-MAY-2021
DEFINITION Cloning vector pTS9, complete sequence.
ACCESSION MW835298
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5191)
AUTHORS Schnabel T.
TITLE Engineering post-translational regulation of glutamine synthetase
for controllable ammonia production in the plant-symbiont A.
brasilense
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 5191)
AUTHORS Schnabel T.
TITLE Direct Submission
JOURNAL Submitted (30-MAR-2021) Bioengineering, Stanford University, 443 Via
Ortega, Stanford, CA 94305, USA
REFERENCE 3 (bases 1 to 5191)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(30-MAR-2021) Bioengineering, Stanford University, 443 Via Ortega,
Stanford, CA 94305, USA"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..5191
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin 139..727
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
regulatory 778..812
/label=pJ23101
/note="pJ23101"
/regulatory_class="promoter"
regulatory 828..842
/label=B0030
/note="B0030"
/regulatory_class="ribosome_binding_site"
gene 849..1868
/gene="pheS*"
/label=pheS*
CDS 849..1868
/codon_start=1
/transl_table=11
/gene="pheS*"
/product="phenylalanine--tRNA ligase alpha subunit"
/function="toxic in presence of 4-chlorophenylalanine"
/label=pheS*
/protein_id="QUQ60671.1"
/translation="MLDALKDELLSQVNAAGDLAALEEVRVTALGKKGRITGFMKELGG
LSPDERRERGQQLNALKDEIAAAIDGRKADLARAHLEARLQAERIDVTLPVRPETEGRI
HPISQTIDEMVAIFAEMGFSVAEGPDVEDDFHNFTALNFPPGHPARDMHDTFYLPDAGD
KKMLLRTHTSPVQVRTMLNKKPPIRIIAPGRTYRSDYDMTHTPMFHQIEGLVIDEATHM
GHLKGCLIEFCRAFFDVDDLPLRFRPSFFPFAEPSAEVDIGCSRKGGELKLGNYGDWLE
ILGCGMVHPNVLEACGIDSTKYQGFGFGMGIERVAMLKYGIPDLRTFFEADLRWLKHY"
regulatory 1885..1997
/label=pKan
/note="pKan"
/regulatory_class="promoter"
oriT complement(1885..1936)
/direction=LEFT
/note="oriT"
CDS 2004..2795
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
misc_feature 2830..2873
/label=multiple cloning site
/note="multiple cloning site"
CDS 2905..2916
/label=Factor Xa site
/note="Factor Xa recognition and cleavage site"
misc_feature 3299..3309
/label=threeway stop
/note="threeway stop"
misc_feature 3316..3362
/note="insert spacer for knock-out or circuit of interest
for knock-in"
misc_feature 3369..3379
/label=threeway stop
/note="threeway stop"
misc_feature 3380..3800
/note="downstream overlap to chromosome (here an example
fragment of A. brasilense Sp245)"
misc_feature 3801..3821
/label=multiple cloning site
/note="multiple cloning site"
oriT complement(3913..4022)
/direction=LEFT
/label=oriT
/note="incP origin of transfer"
promoter 4194..4298
/label=AmpR promoter
CDS 4299..5156
/label=AmpR
/note="beta-lactamase"
This page is informational only.