Basic Vector Information
- Vector Name:
- pMMZ284
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6172 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Mansouri M, Hussherr M-D., Strittmatter T, Buchmann P
- Promoter:
- SV40
pMMZ284 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMMZ284 vector Sequence
LOCUS 62056_17185 6172 bp DNA circular SYN 21-APR-2021
DEFINITION Cloning vector pMMZ284, complete sequence.
ACCESSION MW731449
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6172)
AUTHORS Mansouri M, Hussherr M-D., Strittmatter T, Buchmann P, Xue S,
Camenisch G, Fussenegger M.
TITLE Smart-Watch-Programmed Green-Light-Operated Percutaneous Control of
Therapeutic Transgenes
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 6172)
AUTHORS Mansouri M, Hussherr M-D., Strittmatter T, Buchmann P, Xue S,
Camenisch G, Fussenegger M.
TITLE Direct Submission
JOURNAL Submitted (12-MAR-2021) DBSSE, ETH, Mattenstrasse 26, Basel, Choose
A State 4058, Switzerland
REFERENCE 3 (bases 1 to 6172)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(12-MAR-2021) DBSSE, ETH, Mattenstrasse 26, Basel, Choose A State
4058, Switzerland"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..6172
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind complement(49..65)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(73..89)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(97..127)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(142..163)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(451..1036)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(1210..2067)
/label=AmpR
/note="beta-lactamase"
promoter complement(2068..2172)
/label=AmpR promoter
promoter 2494..2512
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
CDS 2544..3938
/codon_start=1
/transl_table=11
/product="Myr-TtCBD-nGFP"
/label=Myr-TtCBD-nGFP
/note="Supercharged membrane anchored TtCBD"
/protein_id="QTW97888.1"
/translation="MGCINSKRKDASPEDLGTGLLEALLRGDLAGAEALFRRGLRFWGP
EGILEHLLLPVLREVGEAWHRGEIGVAEEHLASTFLRARLQELLDLAGFPPGPPVLVTT
PPGERHEIGAMLAAYHLRRKGVPALYLGPDTPLPDLRALARRLGAGAVVLSALLSEPLR
ALPDGALKDLAPRVFLGGQGAGPEEARRLGAEYMEDLKGLAEALWLPRGPEKEAIASKG
EELFDGVVPILVELDGDVNGHEFSVRGEGEGDATEGELTLKFICTTGELPVPWPTLVTT
LTYGVQCFSDYPDHMDQHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNR
IELKGIDFKEDGNILGHKLEYNFNSHDVYITADKQENGIKAEFEIRHNVEDGSVQLADH
YQQNTPIGDGPVLLPDDHYLSTESALSKDPNEDRDHMVLLEFVTAAGIDHGMDELYKTA
SGSTGV"
polyA_signal 3975..4199
/label=bGH poly(A) signal
/note="bovine growth hormone polyadenylation signal"
rep_origin 4245..4673
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 4687..5016
/label=SV40 promoter
/note="SV40 enhancer and early promoter"
CDS 5083..5874
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
polyA_signal 6051..6172
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
This page is informational only.