Basic Vector Information
- Vector Name:
- pLM160-mNeonGreen
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5347 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Emrich-Mills TZ, Yates G, Barrett J, Grouneva I
pLM160-mNeonGreen vector Map
pLM160-mNeonGreen vector Sequence
LOCUS 62056_14335 5347 bp DNA circular SYN 28-MAR-2021
DEFINITION Cloning vector pLM160-mNeonGreen, complete sequence.
ACCESSION MT737961
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5347)
AUTHORS Emrich-Mills TZ, Yates G, Barrett J, Grouneva I, Lau CS, Walker CE,
Kwok TK, Davey JW, Johnson MP, Mackinder LCM.
TITLE Direct Submission
JOURNAL Submitted (08-JUL-2020) Molecular Biology and Biotechnology,
University of Sheffield, Western Bank, Sheffield, South Yorkshire
S10 2TN, United Kingdom
REFERENCE 2 (bases 1 to 5347)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted
(08-JUL-2020) Molecular Biology and Biotechnology, University of
Sheffield, Western Bank, Sheffield, South Yorkshire S10 2TN, United
Kingdom"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..5347
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 28..735
/label=mNeonGreen
/note="bright monomeric yellow-green fluorescent protein
derived from LanYFP (Shaner et al., 2013)"
CDS 745..810
/label=3xFLAG
/note="three tandem FLAG(R) epitope tags, followed by an
enterokinase cleavage site"
CDS 1908..2711
/codon_start=1
/transl_table=11
/product="APHVIII"
/label=APHVIII
/protein_id="QTE34481.1"
/translation="MDDALRALRGRYPGCEWVVVEDGASGAGVYRLRGGGRELFVKVAA
LGAGVGLLGEAERLVWLAEVGIPVPRVVEGGGDERVAWLVTEAVPGRPASARWPREQRL
DVAVALAGLARSLHALDWERCPFDRSLAVTVPQAARAVAEGSVDLEDLDEERKGWSGER
LLAELERTRPADEDLAVCHGDLCPDNVLLDPRTCEVTGLIDVGRVGRADRHSDLALVLR
ELAHEEDPWFGPECSAAFLREYGRGWDGAVSEEKLAFYRLLDEFF"
rep_origin 3084..3629
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
CDS complement(3728..4540)
/label=KanR
/note="aminoglycoside phosphotransferase"
CDS 4990..5292
/label=ccdB
/note="CcdB, a bacterial toxin that poisons DNA gyrase"
This page is informational only.