Basic Vector Information
- Vector Name:
- Amp_CelR_HQN_RbsR_YQR
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5042 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Rondon RE, Groseclose TM, Short AE, Wilson CJ.
Amp_CelR_HQN_RbsR_YQR vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
Amp_CelR_HQN_RbsR_YQR vector Sequence
LOCUS 62056_376 5042 bp DNA circular SYN 03-DEC-2019
DEFINITION Cloning vector Amp_CelR_HQN_RbsR_YQR, complete sequence.
ACCESSION MN207954
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5042)
AUTHORS Rondon RE, Groseclose TM, Short AE, Wilson CJ.
TITLE Transcriptional programming using engineered systems of
transcription factors and genetic architectures
JOURNAL Nat Commun 10 (1), 4784 (2019)
PUBMED 31636266
REFERENCE 2 (bases 1 to 5042)
AUTHORS Rondon RE, Groseclose T, Short A, Wilson CJ.
TITLE Direct Submission
JOURNAL Submitted (21-JUL-2019) Chemical and Biomolecular Engineering,
Georgia Institute of Technology, 950 Atlantic dr. NW, 5110E,
Atlanta, GA 30332, United States
REFERENCE 3 (bases 1 to 5042)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat
Commun"; date: "2019"; volume: "10"; issue: "1"; pages: "4784"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(21-JUL-2019) Chemical and Biomolecular Engineering, Georgia
Institute of Technology, 950 Atlantic dr. NW, 5110E, Atlanta, GA
30332, United States"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..5042
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 111..299
/label=rop
/note="Rop protein, which maintains plasmids at low copy
number"
misc_feature 404..546
/label=bom
/note="basis of mobility region from pBR322"
promoter 701..805
/label=AmpR promoter
CDS 806..1663
/label=AmpR
/note="beta-lactamase"
promoter 1792..1869
/label=lacI promoter
CDS 1870..2868
/codon_start=1
/transl_table=11
/product="RbsR YQR"
/label=RbsR YQR
/protein_id="QFU95589.1"
/translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
NYIPNRVAQQLAGKASHTIGMLITASTNPFYSELVRGVERSCFERGYSLVLCNTEGDEQ
RMNRNLETLMQKRVDGLLLLCTETHQPSREIMQRYPTVPTVMMDWAPFDGDSDLIQDNS
LLGGDLATQYLIDKGHTRIACITGPLDKTPARLRLEGYRAAMKRAGLNIPDGYEVTGDF
EFNGGFDAMRQLLSHPLRPQAVFTGNDAMAVGVYQALYQAELQVPQDIAVIGYDDIELA
SFMTPPLTTIHQPKDELGELAIDVLIHRITQPTLQQQRLQLTPILMERGSA"
protein_bind 2998..3019
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin 3227..3815
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
promoter 3951..4028
/label=lacIq promoter
/note="In the lacIq allele, a single base change in the
promoter boosts expression of the lacI gene about 10-fold."
CDS 4029..5042
/codon_start=1
/transl_table=11
/product="CelR HQN"
/label=CelR HQN
/protein_id="QFU95590.1"
/translation="MKPVTLYDVAEYAGVSHQTVSNVVNQASHVSAKTREKVEAAIKEL
GYVPNRAARTLVTRRTDTVALVVSENNQKLFAEPFYAGIVLGVGVALSERGFQFVLATG
RSGIEHERLGGYLAGQHVDGVLLLSLHRDDPLPQMLDEAGVPYVYGGRPLGVPEEQVSY
VDIDNIGGGRQATQRLIETGHRRIATIAGPQDMVAGVERLQGYREALLAAGMEYDETLV
SYGDFTYDSGVAAMRELLDRAPDVDAVFAASDLMGLAALRVLRASGRRVPEDVAVVGYD
DSTVAEHAEPPMTSVNQPTELMGREMARLLVDRITGETTEPVRLVLETHLMVRESG"
This page is informational only.