pLDJIG15-yeGFP vector (V016246)

LOCUS       62056_13775        7435 bp DNA     circular SYN 29-MAY-2021
DEFINITION  Cloning vector pLDJIG15-yeGFP, complete sequence.
ACCESSION   MW820853
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7435)
  AUTHORS   Ding L, Brown DM, Glass JI.
  TITLE     Rescue of Infectious Sindbis Virus by Yeast Spheroplast-Mammalian 
            Cell Fusion
  JOURNAL   Viruses 13 (4), 603 (2021)
  PUBMED    33916100
REFERENCE   2  (bases 1 to 7435)
  AUTHORS   Ding L.
  TITLE     Direct Submission
  JOURNAL   
REFERENCE   3  (bases 1 to 7435)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Viruses"; 
            date: "2021"; volume: "13"; issue: "4"; pages: "603"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (23-MAR-2021) Synthetic Biology "
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7435
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        1..442
                     /label=GAL1 promoter
                     /note="inducible promoter, regulated by Gal4"
     misc_feature    443..472
                     /note="primers for yeast viral vector amplication D199;
                     Harvard overlap 7"
     misc_feature    479..484
                     /label=yeast translational entry site
                     /note="yeast translational entry site"
     CDS             485..514
                     /label=Myc
                     /note="Myc (human c-Myc proto-oncogene) epitope tag"
     misc_feature    515..517
                     /note="yeast translational stop codon; Harvard overlap 8"
     misc_feature    518..547
                     /label=primers for yeast viral vector amplication D200
                     /note="primers for yeast viral vector amplication D200"
     terminator      548..735
                     /label=ADH1 terminator
                     /note="transcription terminator for the S. cerevisiae
                     alcohol dehydrogenase 1 (ADH1) gene"
     promoter        760..1403
                     /label=GAP promoter
                     /note="promoter for glyceraldehyde-3-phosphate
                     dehydrogenase; also known as the TDH3 promoter"
     CDS             1421..2128
                     /label=mCherry
                     /note="monomeric derivative of DsRed fluorescent protein
                     (Shaner et al., 2004)"
     CDS             2156..2863
                     /codon_start=1
                     /transl_table=11
                     /product="yeCherry"
                     /label=yeCherry
                     /note="red fluorescence protein; 2nd copy"
                     /protein_id="QVS03012.1"
                     /translation="VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGT
                     QTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFE
                     DGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKG
                     EIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAE
                     GRHSTGGMDELYK"
     terminator      2870..3117
                     /label=CYC1 terminator
                     /note="transcription terminator for CYC1"
     rep_origin      complement(3418..4006)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(4180..4992)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     promoter        complement(4993..5097)
                     /label=AmpR promoter
     misc_feature    5134..5637
                     /label=CEN/ARS
                     /note="S. cerevisiae CEN6 centromere fused to an
                     autonomously replicating sequence"
     promoter        5893..6173
                     /label=TRP1 promoter
     CDS             6174..6845
                     /label=TRP1
                     /note="phosphoribosylanthranilate isomerase, required for 
                     tryptophan biosynthesis"
     rep_origin      complement(6945..7400)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        7435
                     /label=GAL1
                     /note="Saccharomyces cerevisiae galactokinase promoter"