pMJc01 vector (V016208)

LOCUS       62056_17005        5535 bp DNA     circular SYN 22-JAN-2021
DEFINITION  Cloning vector pMJc01, complete sequence.
ACCESSION   MN201591
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5535)
  AUTHORS   Jutersek M, Dolinar M.
  TITLE     A new vector for cyanobacterial biotechnology assayed with cystatin,
            a distinct non-fluorescent reporter protein
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5535)
  AUTHORS   Jutersek M, Dolinar M.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JUL-2019) Faculty of Chemistry and Chemical 
            Technology, Vecna pot 113, Ljubljana SI-1000, Slovenia
REFERENCE   3  (bases 1 to 5535)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (20-JUL-2019) Faculty of Chemistry and Chemical Technology, Vecna 
            pot 113, Ljubljana SI-1000, Slovenia"
FEATURES             Location/Qualifiers
     source          1..5535
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(9..403)
                     /direction=LEFT
                     /label=RSF1010 oriV
                     /note="replication origin of the broad-host-range plasmid 
                     RSF1010; requires the RSF1010 RepA/B/C proteins for 
                     replication (Scholz et al., 1989)"
     protein_bind    473..494
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        509..539
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an 'up' mutation"
     protein_bind    547..563
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     CDS             599..1567
                     /label=RSF1010 RepB
                     /note="replication protein B of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     CDS             1631..1843
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /label=hypothetical protein
                     /note="OrfE"
                     /protein_id="QGN03459.1"
                     /translation="MEYEKSASGSVYLIKSDKGYWLPGGFGYTSNKAEAGRFSVADMAS
                     LNLDGCTLSLFREDKPFGPGKFLGD"
     CDS             1845..2051
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /label=hypothetical protein
                     /note="OrfF"
                     /protein_id="QGN03460.1"
                     /translation="MKDQKDKQTGDLLASPDAVRQARYAERMKAKGMRQRKFWLTDDEY
                     EALRECLEELRAAQGGGSDPASA"
     CDS             2081..2917
                     /label=RSF1010 RepA
                     /note="replication protein A of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     CDS             2907..3755
                     /label=RSF1010 RepC
                     /note="replication protein C of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     CDS             3879..4691
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     terminator      complement(4852..4910)
                     /label=his operon terminator
                     /note="This putative transcriptin terminator from the E.
                     coli his operon has a 2-bp deletion introduced during 
                     synthesis. Its efficiency has not been determined."
     misc_feature    complement(4911..4931)
                     /label=BioBrick suffix
                     /note="universal suffix for all parts"
     CDS             complement(4935..4952)
                     /label=6xHis
                     /note="6xHis affinity tag"
     regulatory      complement(5310..5319)
                     /regulatory_class="ribosome_binding_site"
     protein_bind    complement(5363..5381)
                     /label=tet operator
                     /note="bacterial operator O2 for the tetR and tetA genes"
     misc_feature    complement(5388..5409)
                     /label=BioBrick prefix
                     /note="BioBrick prefix for parts that do not start with
                     'ATG'"
     terminator      5412..5455
                     /label=bacterial terminator
                     /note="putative bacterial transcription terminator"