Basic Vector Information
- Vector Name:
- pLH405
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 4730 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hartsough LA, Kotlajich MV, Han B, Lin C-C.J.
pLH405 vector Map
pLH405 vector Sequence
LOCUS 62056_14145 4730 bp DNA circular SYN 27-JUL-2020
DEFINITION Cloning vector pLH405, complete sequence.
ACCESSION MN617157
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4730)
AUTHORS Hartsough LA, Kotlajich MV, Han B, Lin C-C.J., Gambill L, Wang MC,
Tabor JJ.
TITLE Optogenetic control of gut bacterial metabolism
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 4730)
AUTHORS Hartsough LA, Kotlajich MV, Han B, Lin C-C.J., Gambill L, Wang MC,
Tabor JJ.
TITLE Direct Submission
JOURNAL Submitted (26-OCT-2019) Bioengineering, Rice University, 6500 Main
St., Houston, TX 77030, USA
REFERENCE 3 (bases 1 to 4730)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(26-OCT-2019) Bioengineering, Rice University, 6500 Main St.,
Houston, TX 77030, USA"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..4730
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin complement(72..660)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
terminator complement(748..842)
/label=lambda t0 terminator
/note="transcription terminator from phage lambda"
CDS complement(866..1522)
/label=CmR
/note="chloramphenicol acetyltransferase"
promoter complement(1523..1625)
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
misc_feature 1651..1685
/label=constitutive promoter J23114
/note="constitutive promoter J23114"
regulatory 1693..1706
/label=RBS pprotet
/note="RBS pprotet"
/regulatory_class="ribosome_binding_site"
misc_feature 1695..1706
/label=B0034
/note="B0034"
CDS 1714..2421
/label=mCherry
/note="monomeric derivative of DsRed fluorescent protein
(Shaner et al., 2004)"
regulatory 2425..2484
/label=L3S1P52
/note="L3S1P52"
/regulatory_class="terminator"
regulatory 2564..2598
/label=constitutive promoter J23100
/note="constitutive promoter J23100"
/regulatory_class="promoter"
regulatory 2599..2632
/label=sRBS
/note="sRBS"
/regulatory_class="ribosome_binding_site"
CDS 2633..3337
/codon_start=1
/transl_table=11
/product="CcaR"
/label=CcaR
/protein_id="QLL27764.1"
/translation="MRILLVEDDLPLAETLAEALSDQLYTVDIATDASLAWDYASRLEY
DLVILDVMLPELDGITLCQKWRSHSYLMPILMMTARDTINDKITGLDAGADDYVVKPVD
LGELFARVRALLRRGCATCQPVLEWGPIRLDPSTYEVSYDNEVLSLTRKEYSILELLLR
NGRRVLSRSMIIDSIWKLESPPEEDTVKVHVRSLRQKLKSAGLSADAIETVHGIGYRLA
NLTEKSLCQGKN"
terminator 3358..3429
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 3445..3472
/label=T7Te terminator
/note="phage T7 early transcription terminator"
misc_feature complement(3584..3595)
/label=stop region
/note="stop region"
regulatory 3596..3767
/label=truncated PcpcG2
/note="truncated PcpcG2"
/regulatory_class="promoter"
misc_feature 3768..3785
/label=B0034
/note="B0034"
CDS 3786..4499
/label=yeGFP
/note="yeast-enhanced green fluorescent protein"
terminator complement(4526..4569)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
This page is informational only.