Basic Vector Information
- Vector Name:
- pLG163
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8591 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Gonzalez LM, Mukhitov N, Voigt CA.
pLG163 vector Map
pLG163 vector Sequence
LOCUS 62056_14050 8591 bp DNA circular SYN 16-DEC-2019
DEFINITION Cloning vector pLG163, complete sequence.
ACCESSION MN443775
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 8591)
AUTHORS Gonzalez LM, Mukhitov N, Voigt CA.
TITLE Resilient living materials built by printing bacterial spores
JOURNAL Nat. Chem. Biol. (2019) In press
PUBMED 31792444
REFERENCE 2 (bases 1 to 8591)
AUTHORS Mukhitov N, Gonzalez LM, Voigt CA.
TITLE Direct Submission
JOURNAL Submitted (11-SEP-2019) Biological Engineering, MIT, NE47-140, 500
Tech Square, Cambridge, MA 02139, USA
REFERENCE 3 (bases 1 to 8591)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Chem.
Biol. (2019) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(11-SEP-2019) Biological Engineering, MIT, NE47-140, 500 Tech
Square, Cambridge, MA 02139, USA"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..8591
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 106..210
/label=AmpR promoter
CDS 211..1068
/label=AmpR
/note="beta-lactamase"
rep_origin 1242..1830
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature 2963..4139
/label=similar to AmyE
/note="similar to AmyE"
CDS complement(4266..5018)
/codon_start=1
/transl_table=11
/product="SpecR"
/label=SpecR
/protein_id="QGV56725.1"
/translation="MNTYEQINKVKKILRKHLKNNLIGTYMFGSGVESGLKPNSDLDFL
VVVSEPLTDQSKEILIQKIRPISKKIGDKSNLRYIELTIIIQQEMVPWNHPPKQEFIYG
EWLQELYEQGYIPQKELNSDLTIMLYQAKRKNKRIYGNYDLEELLPDIPFSDVRRAIMD
SSEELIDNYQDDETNSILTLCRMILTMDTGKIIPKDIAGNAVAESSPLEHRERILLAVR
SYLGENIEWTNENVNLTINYLNNRLKKL"
terminator 5347..5433
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 5452..5479
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
terminator 5559..5593
/label=lambda t0 terminator
/note="minimal transcription terminator from phage lambda
(Scholtissek and Grosse, 1987)"
regulatory 5660..5688
/label=pSpank
/note="pSpank"
/regulatory_class="promoter"
protein_bind 5697..5713
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
regulatory 5729..5745
/label=SpoVG
/note="SpoVG"
/regulatory_class="ribosome_binding_site"
CDS 5749..6456
/label=yeGFP
/note="yeast-enhanced green fluorescent protein"
CDS 6715..7794
/label=lacI
/note="lac repressor"
misc_feature 7924..8591
/label=similar to AmyE
/note="similar to AmyE"
This page is informational only.