pso_CelR_HQN vector (Cat. No.: V015929)
Basic Information
- Name:
- pso_CelR_HQN
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3679 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Rondon RE, Groseclose TM, Short AE, Wilson CJ.
pso_CelR_HQN vector (Cat. No.: V015929) Sequence
LOCUS 62056_20070 3679 bp DNA circular SYN 03-DEC-2019
DEFINITION Cloning vector pso_CelR_HQN, complete sequence.
ACCESSION MN207948
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3679)
AUTHORS Rondon RE, Groseclose TM, Short AE, Wilson CJ.
TITLE Transcriptional programming using engineered systems of
transcription factors and genetic architectures
JOURNAL Nat Commun 10 (1), 4784 (2019)
PUBMED 31636266
REFERENCE 2 (bases 1 to 3679)
AUTHORS Rondon RE, Groseclose T, Short A, Wilson CJ.
TITLE Direct Submission
JOURNAL Submitted (21-JUL-2019) Chemical and Biomolecular Engineering,
Georgia Institute of Technology, 950 Atlantic dr. NW, 5110E,
Atlanta, GA 30332, United States
REFERENCE 3 (bases 1 to 3679)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat
Commun"; date: "2019"; volume: "10"; issue: "1"; pages: "4784"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(21-JUL-2019) Chemical and Biomolecular Engineering, Georgia
Institute of Technology, 950 Atlantic dr. NW, 5110E, Atlanta, GA
30332, United States"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..3679
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 101..289
/label=rop
/note="Rop protein, which maintains plasmids at low copy
number"
misc_feature 394..536
/label=bom
/note="basis of mobility region from pBR322"
promoter 693..797
/label=AmpR promoter
CDS 798..1655
/label=AmpR
/note="beta-lactamase"
rep_origin 1829..2417
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
promoter 2553..2630
/label=lacIq promoter
/note="In the lacIq allele, a single base change in the
promoter boosts expression of the lacI gene about 10-fold."
CDS 2631..3644
/codon_start=1
/transl_table=11
/product="CelR HQN"
/label=CelR HQN
/protein_id="QFU95569.1"
/translation="MKPVTLYDVAEYAGVSHQTVSNVVNQASHVSAKTREKVEAAIKEL
GYVPNRAARTLVTRRTDTVALVVSENNQKLFAEPFYAGIVLGVGVALSERGFQFVLATG
RSGIEHERLGGYLAGQHVDGVLLLSLHRDDPLPQMLDEAGVPYVYGGRPLGVPEEQVSY
VDIDNIGGGRQATQRLIETGHRRIATIAGPQDMVAGVERLQGYREALLAAGMEYDETLV
SYGDFTYDSGVAAMRELLDRAPDVDAVFAASDLMGLAALRVLRASGRRVPEDVAVVGYD
DSTVAEHAEPPMTSVNQPTELMGREMARLLVDRITGETTEPVRLVLETHLMVRESG"
This page is informational only.