Basic Vector Information
- Vector Name:
- pLG320
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8388 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Gonzalez LM, Mukhitov N, Voigt CA.
pLG320 vector Map
pLG320 vector Sequence
LOCUS 62056_14075 8388 bp DNA circular SYN 16-DEC-2019
DEFINITION Cloning vector pLG320, complete sequence.
ACCESSION MN443780
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 8388)
AUTHORS Gonzalez LM, Mukhitov N, Voigt CA.
TITLE Resilient living materials built by printing bacterial spores
JOURNAL Nat. Chem. Biol. (2019) In press
PUBMED 31792444
REFERENCE 2 (bases 1 to 8388)
AUTHORS Mukhitov N, Gonzalez LM, Voigt CA.
TITLE Direct Submission
JOURNAL Submitted (11-SEP-2019) Biological Engineering, MIT, NE47-140, 500
Tech Square, Cambridge, MA 02139, USA
REFERENCE 3 (bases 1 to 8388)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Chem.
Biol. (2019) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(11-SEP-2019) Biological Engineering, MIT, NE47-140, 500 Tech
Square, Cambridge, MA 02139, USA"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..8388
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 106..210
/label=AmpR promoter
CDS 211..1068
/label=AmpR
/note="beta-lactamase"
rep_origin 1242..1830
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature 2963..4138
/label=similar to AmyE
/note="similar to AmyE"
gene complement(4263..5045)
/gene="specR"
/label=specR
terminator 5341..5427
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 5446..5473
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
misc_binding 5593..5604
/label=VanO binding site
/bound_moiety="VanO"
regulatory 5621..5649
/label=pSpank
/note="pSpank"
/regulatory_class="promoter"
misc_binding 5647..5658
/label=VanO binding site
/bound_moiety="VanO"
misc_RNA 5660..5710
/label=sTRSV HHRz
/note="hammerhead ribozyme from the tobacco ringspot virus
satellite RNA (Khvorova et al., 2003)"
regulatory 5741..5752
/label=SpoVG
/note="SpoVG"
/regulatory_class="ribosome_binding_site"
CDS 5761..6468
/label=yeGFP
/note="yeast-enhanced green fluorescent protein"
terminator 6524..6618
/label=lambda t0 terminator
/note="transcription terminator from phage lambda"
regulatory 6726..6796
/label=Ppen
/note="Ppen"
/regulatory_class="promoter"
regulatory 6804..6815
/label=SpoVG
/note="SpoVG"
/regulatory_class="ribosome_binding_site"
CDS 6821..7555
/codon_start=1
/transl_table=11
/product="VanR-IVS"
/label=VanR-IVS
/protein_id="QGV56734.1"
/translation="MDMPRIKPGQRVMMALRKMIASGEIKSGERIAEIPTAAALGVSRM
PVRIALRSLEQEGLVVRLGARGYAARGVSSDQIRDAIEVRGVLEGFAARRLAERGMTAE
THARFVVLIAEGEALFAAGRLNGEDLDRYAAYNQAFHDTLVSAAGNGAVESALARNGFE
PFAAAGALALDLMDLSAEYEHLLAAHRQHQAVLDAVSCGDAEGAERIMRDHALAAIRNA
KVFEAAASAGAPLGAAWSIRAD"
misc_feature 7721..8388
/label=similar to AmyE
/note="similar to AmyE"
This page is informational only.