Basic Vector Information
- Vector Name:
- pNATX13-XF36-RS26795
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6084 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Chi Z, Chi Z, Kong C.
pNATX13-XF36-RS26795 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNATX13-XF36-RS26795 vector Sequence
LOCUS 62056_17745 6084 bp RNA circular SYN 30-AUG-2020
DEFINITION Shuttle vector pNATX13-XF36-RS26795, complete sequence.
ACCESSION MT881549
VERSION .
KEYWORDS .
SOURCE
ORGANISM
REFERENCE 1 (bases 1 to 6084)
AUTHORS Chi Z, Chi Z, Kong C.
TITLE Direct Submission
JOURNAL Submitted (07-AUG-2020) Ocean University of China, Qing Dao,
Shandong 266000, China
REFERENCE 2 (bases 1 to 6084)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted
(07-AUG-2020) Ocean University of China, Qing Dao, Shandong 266000,
China"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..6084
/mol_type="other DNA"
promoter 96..200
/label=AmpR promoter
CDS 201..1058
/label=AmpR
/note="beta-lactamase"
rep_origin 1232..1820
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 2108..2129
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 2144..2174
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 2182..2198
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 2206..2222
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
gene 3101..3796
/gene="sfaC"
/label=sfaC
CDS 3101..3796
/codon_start=1
/transl_table=11
/gene="sfaC"
/product="piperazate synthase"
/label=sfaC
/protein_id="QNJ99263.1"
/translation="MYERPLYREDCDGVVLAFLRHNPLAMVVTSHDDVPVATHAPVLFR
HGPDGADAEAVAAGTVPLAGSTLIGHMNVENPQWRRMRSGDRALIVFQGPHGYVSPTVY
GVTPAAPTWDFIAVHVNGTVEPTADPAAVLDIVSDTARRLESGFGRGWDQESSLDYFRQ
IAPGVGAFTLRVDSVQTMFKLSQEKPAPMRRRVVEQFEASESGTHRALASVMRDRGLTE
ADEERETAG"
protein_bind complement(3803..3836)
/label=lox71
/note="Left element (LE) mutant of loxP (Araki et al.,
2010). Cre-mediated recombination occurs in the 8-bp core
sequence (ATGTATGC) (Shaw et al., 2021)."
polyA_signal complement(3847..4021)
/label=CaMV poly(A) signal
/note="cauliflower mosaic virus polyadenylation signal"
CDS complement(4065..4631)
/label=NrsR
/note="nourseothricin acetyltransferase"
protein_bind complement(5078..5111)
/label=lox66
/note="Right element (RE) mutant of loxP (Araki et al.,
2010). Cre-mediated recombination occurs in the 8-bp core
sequence (ATGTATGC) (Shaw et al., 2021)."
primer_bind complement(5690..5706)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
This page is informational only.