FruR_HQN vector (V015770)

Basic Vector Information

Vector Name:
FruR_HQN
Antibiotic Resistance:
Chloramphenicol
Length:
3852 bp
Type:
Cloning vector
Replication origin:
p15A ori
Source/Author:
Rondon RE, Groseclose TM, Short AE, Wilson CJ.

FruR_HQN vector Vector Map

FruR_HQN3852 bp60012001800240030003600lacIq promoterFruR HQNCAP binding sitep15A oricat promoterCmR

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

FruR_HQN vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       62056_836        3852 bp DNA     circular SYN 03-DEC-2019
DEFINITION  Cloning vector FruR_HQN, complete sequence.
ACCESSION   MN207917
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3852)
  AUTHORS   Rondon RE, Groseclose TM, Short AE, Wilson CJ.
  TITLE     Transcriptional programming using engineered systems of 
            transcription factors and genetic architectures
  JOURNAL   Nat Commun 10 (1), 4784 (2019)
  PUBMED    31636266
REFERENCE   2  (bases 1 to 3852)
  AUTHORS   Rondon RE, Groseclose T, Short A, Wilson CJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUL-2019) Chemical and Biomolecular Engineering, 
            Georgia Institute of Technology, 950 Atlantic dr. NW, 5110E, 
            Atlanta, GA 30332, United States
REFERENCE   3  (bases 1 to 3852)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nat 
            Commun"; date: "2019"; volume: "10"; issue: "1"; pages: "4784"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (21-JUL-2019) Chemical and Biomolecular Engineering, Georgia 
            Institute of Technology, 950 Atlantic dr. NW, 5110E, Atlanta, GA 
            30332, United States"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..3852
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        596..673
                     /label=lacIq promoter
                     /note="In the lacIq allele, a single base change in the
                     promoter boosts expression of the lacI gene about 10-fold."
     CDS             674..1678
                     /codon_start=1
                     /transl_table=11
                     /product="FruR HQN"
                     /label=FruR HQN
                     /protein_id="QFU95499.1"
                     /translation="MKPVTLYDVAEYAGVSHQTVSNVVNQASHVSAKTREKVEAAMAEL
                     NYIPNRVAQQLAGKSSRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
                     NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD
                     QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVHFLYANSYER
                     EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDNELLDF
                     LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIKRNLYRRGVLSRS"
     protein_bind    1808..1829
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      2020..2564
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     promoter        3090..3192
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             3193..3849
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"

This page is informational only.